DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ pekarsky-2008-1 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260521X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions imex curation pekarsky-2008-2 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260507X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions imex curation pekarsky-2008-3 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260517X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions imex curation pekarsky-2008-4 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260516X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions imex curation pekarsky-2008-5 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260512X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions imex curation pekarsky-2008-6 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260508X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions imex curation pekarsky-2008-7 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260522X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions imex curation pekarsky-2008-8 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260518X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions imex curation pekarsky-2008-9 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260513X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions imex curation pekarsky-2008-10 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260509X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions imex curation pekarsky-2008-11 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260514X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions imex curation pekarsky-2008-12 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260519X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions imex curation pekarsky-2008-13 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260515X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions imex curation pekarsky-2008-14 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260510X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions imex curation pekarsky-2008-15 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260520X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions imex curation pekarsky-2008-16 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260511X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions imex curation tcl1a_human T-cell leukemia/lymphoma protein 1A Protein p14 TCL1 Oncogene TCL-1 TCL1A TCL1 protein protein human Homo sapiens Human MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD jun_human Transcription factor AP-1 JUN Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog p39 protein protein human Homo sapiens Human MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF ep300_human Histone acetyltransferase p300 Histone butyryltransferase p300 Histone crotonyltransferase p300 Protein propionyltransferase p300 EP300 P300 E1A-associated protein p300 Protein 2-hydroxyisobutyryltransferase p300 Protein lactyltransferas p300 protein protein human Homo sapiens Human MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGDINQLQTSLGMVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINSMVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYGSPYTQNPGQQIGASGLGLQIQTKTVLSNNLSPFAMDKKAVPGGGMPNMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQQPILTGAPVGLGNPSSLGVGQQSAPNLSTVSQIDPSSIERAYAALGLPYQVNQMPTQPQVQAKNQQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQNPMMSENASVPSLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPNAAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQSGLNQFGQMSMAQPPIVPRQTPPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTPTPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQPSLPAAPSADQPQQQPRSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSSTEVNSQAIAEKQPSQEVKMEAKMEVDQPEPADTQPEDISESKVEDCKMESTETEERSTELKTEIKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTGQQPTTPQTPQPTSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPPMTPMAPMGMNPPPMTRGPSGHLEPGMGPTGMQQQPPWSQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGISPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPIPGQPGMPQGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGGMSPQAQQMNMNHNTMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYPPQQQQRMQHHMQQMQQGNMGQIGQLPQALGAEAGASLQAYQQRLLQQQMGSPVQPNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNSDLNSNLSQSTLDIH fos_human Proto-oncogene c-Fos Cellular oncogene fos G0/G1 switch regulatory protein 7 FOS G0S7 protein protein human Homo sapiens Human MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL junb_human Transcription factor jun-B JUNB protein protein human Homo sapiens Human MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPPVYTNLSSYSPASASSGGAGAAVGTGSSYPTTTISYLPHAPPFAGGHPAQLGLGRGASTFKEEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKVKTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF tcl1a-jun-1 3181327 N/A 3181343 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3181344 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false ep300-tcl1a-1 3181328 N/A 3181343 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3181345 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false tcl1a-jun-2 3181329 N/A 3181343 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3181344 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false tcl1a-fos-1 3181330 N/A 3181343 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3181346 unspecified role unspecified role prey prey V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false jun-tcl1a-1 3181331 N/A 3181343 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3181344 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false fos-tcl1a-1 3181332 N/A 3181343 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3181346 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false tcl1a-jun-3 3181333 N/A 3181343 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3181344 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false fos-tcl1a-2 3181334 N/A 3181343 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3181346 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false jun-tcl1a-2 3181335 N/A 3181343 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3181344 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false jun-tcl1a-3 3181336 N/A 3181343 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3181344 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false tcl1a-ep300-1 3181337 N/A 3181343 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3181345 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false tcl1a-fos-2 3181338 N/A 3181343 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3181346 unspecified role unspecified role prey prey V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false tcl1a-ep300-2 3181339 N/A 3181343 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3181345 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false junb-tcl1a-1 3181340 N/A 3181343 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3181347 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false tcl1a-junb-1 3181341 N/A 3181343 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3181347 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false ep300-tcl1a-2 3181342 N/A 3181343 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3181345 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false