DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ cai-2008-8 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Cai H., Reim K., Varoqueaux F., Tapechum S., Hill K., Sørensen JB., Brose N., Chow RH. DIP original experiment: DIP-133519X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Complexin II plays a positive role in Ca2+-triggered exocytosis by facilitating vesicle priming. Cai H., Reim K., Varoqueaux F., Tapechum S., Hill K., Sørensen JB., Brose N., Chow RH. Only protein-protein interactions imex curation cplx2_rat Complexin-2 Cplx2 Complexin II Synaphin-1 protein protein rat Rattus norvegicus (Rat) Rat MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK vamp2_rat Vesicle-associated membrane protein 2 Vamp2 Syb2 Synaptobrevin-2 protein protein rat Rattus norvegicus (Rat) Rat MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST snp25_rat Synaptosomal-associated protein 25 Snap25 Snap Synaptosomal-associated 25 kDa protein Super protein protein protein rat Rattus norvegicus (Rat) Rat MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG cplx2-snap25-1 3180649 N/A 3180650 unspecified role unspecified role bait bait P84087:p.Arg59His R59H mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P84087:p.Arg63Ala R63A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P84087:p.[Lys69Ala;Tyr70Ala] K69A/Y70A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3180651 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat N/A 3180652 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat association association false false false