DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ guo-2008-6 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Guo M., Xu F., Yamada J., Egelhofer T., Gao Y., Hartzog GA., Teng M., Niu L. DIP original experiment: DIP-113487X Structure (London, England : 1993) 2008 IMEx Core structure of the yeast spt4-spt5 complex: a conserved module for regulation of transcription elongation. Guo M., Xu F., Yamada J., Egelhofer T., Gao Y., Hartzog GA., Teng M., Niu L. Only protein-protein interactions imex curation guo-2008-7 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Guo M., Xu F., Yamada J., Egelhofer T., Gao Y., Hartzog GA., Teng M., Niu L. DIP original experiment: DIP-113492X Structure (London, England : 1993) 2008 IMEx Core structure of the yeast spt4-spt5 complex: a conserved module for regulation of transcription elongation. Guo M., Xu F., Yamada J., Egelhofer T., Gao Y., Hartzog GA., Teng M., Niu L. Only protein-protein interactions imex curation guo-2008-8 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Guo M., Xu F., Yamada J., Egelhofer T., Gao Y., Hartzog GA., Teng M., Niu L. DIP original experiment: DIP-113490X Structure (London, England : 1993) 2008 IMEx Core structure of the yeast spt4-spt5 complex: a conserved module for regulation of transcription elongation. Guo M., Xu F., Yamada J., Egelhofer T., Gao Y., Hartzog GA., Teng M., Niu L. Only protein-protein interactions imex curation guo-2008-9 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Guo M., Xu F., Yamada J., Egelhofer T., Gao Y., Hartzog GA., Teng M., Niu L. DIP original experiment: DIP-113488X Structure (London, England : 1993) 2008 IMEx Core structure of the yeast spt4-spt5 complex: a conserved module for regulation of transcription elongation. Guo M., Xu F., Yamada J., Egelhofer T., Gao Y., Hartzog GA., Teng M., Niu L. Only protein-protein interactions imex curation guo-2008-10 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Guo M., Xu F., Yamada J., Egelhofer T., Gao Y., Hartzog GA., Teng M., Niu L. DIP original experiment: DIP-113491X Structure (London, England : 1993) 2008 IMEx Core structure of the yeast spt4-spt5 complex: a conserved module for regulation of transcription elongation. Guo M., Xu F., Yamada J., Egelhofer T., Gao Y., Hartzog GA., Teng M., Niu L. Only protein-protein interactions imex curation guo-2008-11 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Guo M., Xu F., Yamada J., Egelhofer T., Gao Y., Hartzog GA., Teng M., Niu L. DIP original experiment: DIP-113489X Structure (London, England : 1993) 2008 IMEx Core structure of the yeast spt4-spt5 complex: a conserved module for regulation of transcription elongation. Guo M., Xu F., Yamada J., Egelhofer T., Gao Y., Hartzog GA., Teng M., Niu L. Only protein-protein interactions imex curation spt5_metja Transcription elongation factor Spt5 spt5 MJ0372 protein protein metja Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Methanococcus jannaschii MIFAVRTMVGQEKNIAGLMASRAEKEQLDVYSILASESLKGYVLVEAETKGDVEELIKGMPRVRGIVPGTIAIEEIEPLLTPKKIIENIEKGDVVEIIAGPFKGERAKVIRVDKHKEEVTLELENAAVPIPITLPVEGVKIVSKHKD A8D917571BF5F215 spt4_metja Transcription elongation factor Spt4 spt4 rpoE'' rpoE2 MJ0396 protein protein metja Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Methanococcus jannaschii MRACLKCKYLTNDEICPICHSPTSENWIGLLIVINPEKSEIAKKAGIDIKGKYALSVKE CFC635FF7C1B0919 spt5_yeast Transcription elongation factor SPT5 SPT5 YML010W YM9571.08 Chromatin elongation factor SPT5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDNSDTNVSMQDHDQQFADPVVVPQSTDTKDENTSDKDTVDSGNVTTTESTERAESTSNIPPLDGEEKEAKSEPQQPEDNAETAATEQVSSSNGPATDDAQATLNTDSSEANEIVKKEEGSDERKRPREEDTKNSDGDTKDEGDNKDEDDDEDDDDDDDDEDDDDEAPTKRRRQERNRFLDIEAEVSDDEDEDEDEEDSELVREGFITHGDDEDDEASAPGARRDDRLHRQLDQDLNKTSEEDAQRLAKELRERYGRSSSKQYRAAAQDGYVPQRFLLPSVDTATIWGVRCRPGKEKELIRKLLKKKFNLDRAMGKKKLKILSIFQRDNYTGRIYIEAPKQSVIEKFCNGVPDIYISQKLLIPVQELPLLLKPNKSDDVALEEGSYVRIKRGIYKGDLAMVDQISENNLEVMLKIVPRLDYGKFDEIDPTTQQRKSRRPTFAHRAPPQLFNPTMALRLDQANLYKRDDRHFTYKNEDYIDGYLYKSFRIQHVETKNIQPTVEELARFGSKEGAVDLTSVSQSIKKAQAAKVTFQPGDRIEVLNGEQRGSKGIVTRTTKDIATIKLNGFTTPLEFPISTLRKIFEPGDHVTVINGEHQGDAGLVLMVEQGQVTFMSTQTSREVTITANNLSKSIDTTATSSEYALHDIVELSAKNVACIIQAGHDIFKVIDETGKVSTITKGSILSKINTARARVSSVDANGNEIKIGDTIVEKVGSRREGQVLYIQTQQIFVVSKKIVENAGVFVVNPSNVEAVASKDNMLSNKMDLSKMNPEIISKMGPPSSKTFQQPIQSRGGREVALGKTVRIRSAGYKGQLGIVKDVNGDKATVELHSKNKHITIDKHKLTYYNREGGEGITYDELVNRRGRVPQARMGPSYVSAPRNMATGGIAAGAAATSSGLSGGMTPGWSSFDGGKTPAVNAHGGSGGGGVSSWGGASTWGGQGNGGASAWGGAGGGASAWGGQGTGATSTWGGASAWGNKSSWGGASTWASGGESNGAMSTWGGTGDRSAYGGASTWGGNNNNKSTRDGGASAWGNQDDGNRSAWNNQGNKSNYGGNSTWGGH E4324DB6B1E4721A spt4_yeast Transcription elongation factor SPT4 YGR063C SPT4 Chromatin elongation factor SPT4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSERACMLCGIVQTTNEFNRDGCPNCQGIFEEAGVSTMECTSPSFEGLVGMCKPTKSWVAKWLSVDHSIAGMYAIKVDGRLPAEVVELLPHYKPRDGSQVE 59C164193ABA883B rpoe"-nusg-1 3179856 N/A 3179862 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3179863 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false spt4-spt5-2 3179857 N/A 3179864 unspecified role unspecified role unspecified role unspecified role Region 285-375 Region 285-375 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3179865 unspecified role unspecified role unspecified role unspecified role Region 1-99 Region 1-99 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false spt4-spt5-3 3179858 N/A 3179864 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3179865 unspecified role unspecified role unspecified role unspecified role Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false nusg-rpoe"-1 3179859 N/A 3179862 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3179863 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false spt4-spt5-4 3179860 N/A 3179864 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3179865 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false nusg-rpoe"-2 3179861 N/A 3179862 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3179863 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false