DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ sun-2008-17 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sun J., Lin X. DIP original experiment: DIP-260462X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Beta-arrestin 2 is required for lysophosphatidic acid-induced NF-kappaB activation. Sun J., Lin X. Only protein-protein interactions imex curation sun-2008-18 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sun J., Lin X. DIP original experiment: DIP-260466X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Beta-arrestin 2 is required for lysophosphatidic acid-induced NF-kappaB activation. Sun J., Lin X. Only protein-protein interactions imex curation sun-2008-19 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Sun J., Lin X. DIP original experiment: DIP-260460X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Beta-arrestin 2 is required for lysophosphatidic acid-induced NF-kappaB activation. Sun J., Lin X. Only protein-protein interactions imex curation sun-2008-20 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sun J., Lin X. DIP original experiment: DIP-260468X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Beta-arrestin 2 is required for lysophosphatidic acid-induced NF-kappaB activation. Sun J., Lin X. Only protein-protein interactions imex curation sun-2008-21 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sun J., Lin X. DIP original experiment: DIP-260464X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Beta-arrestin 2 is required for lysophosphatidic acid-induced NF-kappaB activation. Sun J., Lin X. Only protein-protein interactions imex curation sun-2008-22 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Sun J., Lin X. DIP original experiment: DIP-260463X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Beta-arrestin 2 is required for lysophosphatidic acid-induced NF-kappaB activation. Sun J., Lin X. Only protein-protein interactions imex curation sun-2008-23 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sun J., Lin X. DIP original experiment: DIP-260469X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Beta-arrestin 2 is required for lysophosphatidic acid-induced NF-kappaB activation. Sun J., Lin X. Only protein-protein interactions imex curation sun-2008-24 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Sun J., Lin X. DIP original experiment: DIP-260461X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Beta-arrestin 2 is required for lysophosphatidic acid-induced NF-kappaB activation. Sun J., Lin X. Only protein-protein interactions imex curation sun-2008-25 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sun J., Lin X. DIP original experiment: DIP-260465X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Beta-arrestin 2 is required for lysophosphatidic acid-induced NF-kappaB activation. Sun J., Lin X. Only protein-protein interactions imex curation sun-2008-26 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Sun J., Lin X. DIP original experiment: DIP-260467X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Beta-arrestin 2 is required for lysophosphatidic acid-induced NF-kappaB activation. Sun J., Lin X. Only protein-protein interactions imex curation car10_mouse Caspase recruitment domain-containing protein 10 Card10 Bimp1 Bcl10-interacting MAGUK protein 1 protein protein mouse Mus musculus Mouse MQGRADAGEADEEAGAGSGSEAEEDALWERIEGVRHRLTRALNPAKLTPYLRQCRVLDEQDEEEVLSTYRFPCRANRTGRLIDILRCRGKRGFEAFLEALEFYYPEHFTLLTGQEPAQRCSMILDEEGPEGLTQFLMTEVRRLREARKSQLHREQQLQARGRALEEERAGLEQRLREQQQAQERCQRLREDWEAGSLELLRLKDENYMIAMRLAQLSEEKNSAVLRSRDLQLAVDQLKLKVSRLEEECALLRRARGPPPGAEEKEREPDGADLLSELRAENQRLTASLQELQEGLQQEMSRPGAAGSERILLDILEHDWREAQDSRQELCQKLHAVQGELQWAEELRDKYLQEMEDLRLKHRTLLKDCDLYKHRMATVLAQLEEIEKERDQAIQSRDRIQLQYSQSLIEKDQYRKQVRGLEAERDELLTTVTSLEGTKAMLEAQLQRTQGGSCLKACASSHSLCSNLSSTWSLSEFPSPLGGPEATGEAGGSEPHTSEEATDSEKEINRLSILPFPPSAGSILRRQREEDPEPPKRSFSSMSDITGSVTLKPWSPGLSSSSSSDSVWPLGKPEGLLARGCGLDFLNRSLAIRVSGWSPPAGLDPQDKSPDSMPGLGDRWSGAVVRRVLSGPGSARTEQKEPRAEGTGLEGAGLEAEAQQRTLPWNQSSTLPFLLDSKACHSFHEALDAWAKGPGAEPFYIRANFSLPERSDPHALCVKAQEILRLVDPAHKRRQEWFCTRVDTLTLRDLDRGTVPNYQRAQQLLEVQEKYLISSRHRSPRSNLKKRALGLVRPKPAGGTAGDSAEQLPAEPCSELERSLKPYSLVRPLLVSALRPVVLLPECLAPRLIRNLLDLPSSRLDFQVCPAESLSGEEQCTSSAPGAPKAWPATAGLGSRIRAIQESVGKKHCLLELGARGVRELVHSEVYPIVIHVEVTEKNVREIRGLLGRPGWRDSELLRQCRGSEQWLWGLPCSWVQVPAHAWGHAEELAKVVRGRILQEQARLVWVERGSSRGGSGSSSEA mint Activates NF-kappa-B via BCL10 and IKK arrb2_mouse Beta-arrestin-2 Arrestin beta-2 Arrb2 protein protein mouse Mus musculus Mouse MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLFIATYQAFPPMPNPPRPPTRLQDRLLKKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSIEEKSHKRNSVRLIIRKVQFAPETPGPQPSAETTRHFLMSDRRSLHLEASLDKELYYHGEPLNVNVHVTNNSAKTVKKIRVSVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGQLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHITLPRPQSAPRETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDCDDQFC arrb1_mouse Beta-arrestin-1 Arrestin beta-1 Arrb1 protein protein mouse Mus musculus Mouse MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHACPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDNVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPESETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKDEEDDGTGSPHLNNR lpar1_mouse Lysophosphatidic acid receptor 1 Gpcr26 Lpa1 Vzg1 Edg2 Lysophosphatidic acid receptor Edg-2 Rec1.3 VZG-1 Lpar1 protein protein mouse Mus musculus Mouse MAAASTSSPVISQPQFTAMNEQQCFYNESIAFFYNRSGKYLATEWNTVSKLVMGLGITVCVFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVSTWLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGAIPSVGWNCICDIDHCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMSRHSSGPRRNRDTMMSLLKTVVIVLGAFIVCWTPGLVLLLLDVCCPQCDVLAYEKFFLLLAEFNSAMNPIIYSYRDKEMSATFRQILCCQRNENPNGPTEGSDRSASSLNHTILAGVHSNDHSVV mint Receptor for lysophosphatidic acid (LPA), a mediator of diverse cellular activities. Seems to be coupled to the G(i)/G(o), G(12)/G(13), and G(q) families of heteromeric G proteins card10-arrb1-1 3179257 N/A 3179267 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3179268 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3179269 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association false false false card10-arrb2-1 3179258 N/A 3179270 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3179267 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3179268 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human association association false false false arrb1-card10-1 3179259 N/A 3179267 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3179269 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false card10-arrb1-2 3179260 N/A 3179267 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3179269 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false arrb2-card10-1 3179261 N/A 3179267 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3179268 unspecified role unspecified role bait bait Region 1-320 Region 1-320 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 60-410 Region 60-410 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false card10-arrb1-3 3179262 N/A 3179267 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3179269 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false card10-arrb2-2 3179263 N/A 3179267 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3179268 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false arrb2-card10-2 3179264 N/A 3179267 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3179268 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false card10-arrb2-3 3179265 N/A 3179267 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3179268 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false card10-arrb2-4 3179266 N/A 3179267 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3179268 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false