DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ okon-2008-1 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Okon M., Moraes TF., Lario PI., Creagh AL., Haynes CA., Strynadka NC., McIntosh LP. DIP original experiment: DIP-113236X Structure (London, England : 1993) 2008 IMEx Structural characterization of the type-III pilot-secretin complex from Shigella flexneri. Okon M., Moraes TF., Lario PI., Creagh AL., Haynes CA., Strynadka NC., McIntosh LP. Only protein-protein interactions imex curation okon-2008-2 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Okon M., Moraes TF., Lario PI., Creagh AL., Haynes CA., Strynadka NC., McIntosh LP. DIP original experiment: DIP-113234X Structure (London, England : 1993) 2008 IMEx Structural characterization of the type-III pilot-secretin complex from Shigella flexneri. Okon M., Moraes TF., Lario PI., Creagh AL., Haynes CA., Strynadka NC., McIntosh LP. Only protein-protein interactions imex curation okon-2008-3 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Okon M., Moraes TF., Lario PI., Creagh AL., Haynes CA., Strynadka NC., McIntosh LP. DIP original experiment: DIP-113235X Structure (London, England : 1993) 2008 IMEx Structural characterization of the type-III pilot-secretin complex from Shigella flexneri. Okon M., Moraes TF., Lario PI., Creagh AL., Haynes CA., Strynadka NC., McIntosh LP. Only protein-protein interactions imex curation sctg_shifl Type 3 secretion system pilotin Lipoprotein MxiM MxiD pilot Secretin pilot protein sctG CP0143 mxiM protein protein shifl Shigella flexneri MIRHGSNKLKIFILSILLLTLSGCALKSSSNSEKEWHIVPVSKDYFSIPNDLLWSFNTTNKSINVYSKCISGKAVYSFNAGKFMGNFNVKEVDGCFMDAQKIAIDKLFSMLKDGVVLKGNKINDTILIEKDGEVKLKLIRGI sctc_shifl Type 3 secretion system secretin sctC Outer membrane protein MxiD mxiD CP0145 protein protein shifl Shigella flexneri MKKFNIKSLTLLIVLLPLIVNANNIDSHLLEQNDIAKYVAQSDTVGSFFERFSALLNYPIVVSKQAAKKRISGEFDLSNPEEMLEKLTLLVGLIWYKDGNALYIYDSGELISKVILLENISLNYLIQYLKDANLYDHRYPIRGNISDKTFYISGPPALVELVANTATLLDKQVSSIGTDKVNFGVIKLKNTFVSDRTYNMRGEDIVIPGVATVVERLLNNGKALSNRQAQNDPMPPFNITQKVSEDSNDFSFSSVTNSSILEDVSLIAYPETNSILVKGNDQQIQIIRDIITQLDVAKRHIELSLWIIDIDKSELNNLGVNWQGTASFGDSFGASFNMSSSASISTLDGNKFIASVMALNQKKKANVVSRPVILTQENIPAIFDNNRTFYVSLVGERNSSLEHVTYGTLINVIPRFSSRGQIEMSLTIEDGTGNSQSNYNYNNENTSVLPEVGRTKISTIARVPQGKSLLIGGYTHETNSNEIISIPFLSSIPVIGNVFKYKTSNISNIVRVFLIQPREIKESSYYNTAEYKSLISEREIQKTTQIIPSETTLLEDEKSLVSYLNY mxid-mxim-1 3178869 N/A 3178872 unspecified role unspecified role unspecified role unspecified role Region 28-142 Region 28-142 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3178873 unspecified role unspecified role unspecified role unspecified role Region 521-566 Region 521-566 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false mxid-mxim-2 3178870 N/A 3178872 unspecified role unspecified role unspecified role unspecified role Region 28-142 Region 28-142 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3178873 unspecified role unspecified role unspecified role unspecified role Region 549-566 Region 549-566 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false mxid-mxim-3 3178871 N/A 3178872 unspecified role unspecified role unspecified role unspecified role Region 28-142 Region 28-142 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3178873 unspecified role unspecified role unspecified role unspecified role Region 549-566 Region 549-566 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false