DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ erlandson-2008-1 in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Erlandson KJ., Miller SB., Nam Y., Osborne AR., Zimmer J., Rapoport TA. DIP original experiment: DIP-250209X Nature 2008 IMEx A role for the two-helix finger of the SecA ATPase in protein translocation. Erlandson KJ., Miller SB., Nam Y., Osborne AR., Zimmer J., Rapoport TA. Only protein-protein interactions imex curation erlandson-2008-2 in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Erlandson KJ., Miller SB., Nam Y., Osborne AR., Zimmer J., Rapoport TA. DIP original experiment: DIP-250210X Nature 2008 IMEx A role for the two-helix finger of the SecA ATPase in protein translocation. Erlandson KJ., Miller SB., Nam Y., Osborne AR., Zimmer J., Rapoport TA. Only protein-protein interactions imex curation erlandson-2008-3 in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Erlandson KJ., Miller SB., Nam Y., Osborne AR., Zimmer J., Rapoport TA. DIP original experiment: DIP-250211X Nature 2008 IMEx A role for the two-helix finger of the SecA ATPase in protein translocation. Erlandson KJ., Miller SB., Nam Y., Osborne AR., Zimmer J., Rapoport TA. Only protein-protein interactions imex curation secy_ecoli Protein translocase subunit SecY secY prlA b3300 JW3262 protein protein ecoli Escherichia coli (strain K12) MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTIIEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYTRYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITERGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLVLLLVAVLVFAVTFFVVFVERGQRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGWNWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQVQTLMMSSQYESALKKANLKGYGR ompa_ecoli Outer membrane protein A ompA tolG tut con Outer membrane protein II* b0957 JW0940 Outer membrane porin A Outer membrane protein 3A Outer membrane protein B Outer membrane protein d protein protein ecoli Escherichia coli (strain K12) MKKTAIAIAVALAGFATVAQAAPKDNTWYTGAKLGWSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA seca_ecoli Protein translocase subunit SecA secA azi pea prlD b0098 JW0096 protein protein ecoli Escherichia coli (strain K12) MLIKLLTKVFGSRNDRTLRRMRKVVNIINAMEPEMEKLSDEELKGKTAEFRARLEKGEVLENLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNERCIAEMRTGEGKTLTATLPAYLNALTGKGVHVVTVNDYLAQRDAENNRPLFEFLGLTVGINLPGMPAPAKREAYAADITYGTNNEYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTPLIISGPAEDSSEMYKRVNKIIPHLIRQEKEDSETFQGEGHFSVDEKSRQVNLTERGLVLIEELLVKEGIMDEGESLYSPANIMLMHHVTAALRAHALFTRDVDYIVKDGEVIIVDEHTGRTMQGRRWSDGLHQAVEAKEGVQIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAFEFSSIYKLDTVVVPTNRPMIRKDLPDLVYMTEAEKIQAIIEDIKERTAKGQPVLVGTISIEKSELVSNELTKAGIKHNVLNAKFHANEAAIVAQAGYPAAVTIATNMAGRGTDIVLGGSWQAEVAALENPTAEQIEKIKADWQVRHDAVLEAGGLHIIGTERHESRRIDNQLRGRSGRQGDAGSSRFYLSMEDALMRIFASDRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVESRNFDIRKQLLEYDDVANDQRRAIYSQRNELLDVSDVSETINSIREDVFKATIDAYIPPQSLEEMWDIPGLQERLKNDFDLDLPIAEWLDKEPELHEETLRERILAQSIEVYQRKEEVVGAEMMRHFEKGVMLQTLDSLWKEHLAAMDYLRQGIHLRGYAQKDPKQEYKRESFSMFAAMLESLKYEVISTLSKVQVRMPEEVEELEQQRRMEAERLAQMQQLSHQDDDSAAAAALAAQTGERKVGRNDPCPCGSGKKYKQCHGRLQ ompa-secy-1 3178458 N/A 3178461 unspecified role unspecified role unspecified role unspecified role P0AGA2:p.Ser282Cys S282C mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3178462 unspecified role unspecified role unspecified role unspecified role P0A910:p.Gly186Cys G186C mutation mutation certain certain sequence position certain certain certain sequence position certain false P0A910:p.Val187Cys V187C mutation mutation certain certain sequence position certain certain certain sequence position certain false P0A910:p.Ser188Cys S188C mutation mutation certain certain sequence position certain certain certain sequence position certain false P0A910:p.Arg190Cys R190C mutation mutation certain certain sequence position certain certain certain sequence position certain false P0A910:p.Phe191Cys F191C mutation mutation certain certain sequence position certain certain certain sequence position certain false P0A910:p.Gly192Cys G192C mutation mutation certain certain sequence position certain certain certain sequence position certain false P0A910:p.Gln193Cys Q193C mutation mutation certain certain sequence position certain certain certain sequence position certain false P0A910:p.Gly194Cys G194C mutation mutation certain certain sequence position certain certain certain sequence position certain false P0A910:p.Glu195Cys E195C mutation mutation certain certain sequence position certain certain certain sequence position certain false P0A910:p.Ala196Cys A196C mutation mutation certain certain sequence position certain certain certain sequence position certain false P0A910:p.[Gly194Cys;Ala201Cys] G194C/A201C mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false ompa-seca-1 3178459 N/A 3178463 unspecified role unspecified role unspecified role unspecified role P10408:p.Ala795Cys A759C mutation mutation certain certain sequence position certain certain certain sequence position certain false P10408:p.Tyr794Cys Y794C mutation mutation certain certain sequence position certain certain certain sequence position certain false P10408:p.Asp798Cys D798C mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3178461 unspecified role unspecified role unspecified role unspecified role P0AGA2:p.Ser282Cys S282C mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3178462 unspecified role unspecified role unspecified role unspecified role P0A910:p.[Gly194Cys;Ala201Cys] G194C/A201C mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P0A910:p.[Gly194Cys;Pro202Cys] G194C/P202C mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P0A910:p.[Gly194Cys;Ala203Cys] G194C/A203C mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P0A910:p.[Gly194Cys;Pro204Cys] G194C/P204C mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P0A910:p.[Gly194Cys;Ala205Cys] G194C/A205C mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false ompa-seca-2 3178460 N/A 3178463 unspecified role unspecified role unspecified role unspecified role P10408:p.Ile789Cys I789C mutation mutation certain certain sequence position certain certain certain sequence position certain false P10408:p.Tyr794Cys Y794C mutation mutation certain certain sequence position certain certain certain sequence position certain false P10408:p.Ala795Cys A759C mutation mutation certain certain sequence position certain certain certain sequence position certain false P10408:p.Lys797Cys K797C mutation mutation certain certain sequence position certain certain certain sequence position certain false P10408:p.Asp798Cys D798C mutation mutation certain certain sequence position certain certain certain sequence position certain false P10408:p.Gln801Cys Q801C mutation mutation certain certain sequence position certain certain certain sequence position certain false P10408:p.Glu802Cys E802C mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3178462 unspecified role unspecified role unspecified role unspecified role P0A910:p.[Gly194Cys;Ala205Cys] G194C/A205C mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P0A910:p.[Gly194Cys;Pro204Cys] G194C/P204C mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P0A910:p.[Gly194Cys;Ala203Cys] G194C/A203C mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P0A910:p.[Gly194Cys;Pro202Cys] G194C/P202C mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P0A910:p.[Gly194Cys;Ala201Cys] G194C/A201C mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P0A910:p.[Gly194Cys;Pro198Cys] G194C/P198C mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P0A910:p.[Gly194Cys;Val199Cys] G194C/V199C mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P0A910:p.[Gly194Cys;Val200Cys] G194C/V200C mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false