DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zimmer-2008-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zimmer J., Nam Y., Rapoport TA. DIP original experiment: DIP-250206X Nature 2008 IMEx Structure of a complex of the ATPase SecA and the protein-translocation channel. Zimmer J., Nam Y., Rapoport TA. Only protein-protein interactions imex curation zimmer-2008-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zimmer J., Nam Y., Rapoport TA. DIP original experiment: DIP-250202X Nature 2008 IMEx Structure of a complex of the ATPase SecA and the protein-translocation channel. Zimmer J., Nam Y., Rapoport TA. Only protein-protein interactions imex curation zimmer-2008-3 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zimmer J., Nam Y., Rapoport TA. DIP original experiment: DIP-250208X Nature 2008 IMEx Structure of a complex of the ATPase SecA and the protein-translocation channel. Zimmer J., Nam Y., Rapoport TA. Only protein-protein interactions imex curation zimmer-2008-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zimmer J., Nam Y., Rapoport TA. DIP original experiment: DIP-250205X Nature 2008 IMEx Structure of a complex of the ATPase SecA and the protein-translocation channel. Zimmer J., Nam Y., Rapoport TA. Only protein-protein interactions imex curation zimmer-2008-5 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zimmer J., Nam Y., Rapoport TA. DIP original experiment: DIP-250203X Nature 2008 IMEx Structure of a complex of the ATPase SecA and the protein-translocation channel. Zimmer J., Nam Y., Rapoport TA. Only protein-protein interactions imex curation zimmer-2008-6 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zimmer J., Nam Y., Rapoport TA. DIP original experiment: DIP-250207X Nature 2008 IMEx Structure of a complex of the ATPase SecA and the protein-translocation channel. Zimmer J., Nam Y., Rapoport TA. Only protein-protein interactions imex curation zimmer-2008-7 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zimmer J., Nam Y., Rapoport TA. DIP original experiment: DIP-250204X Nature 2008 IMEx Structure of a complex of the ATPase SecA and the protein-translocation channel. Zimmer J., Nam Y., Rapoport TA. Only protein-protein interactions imex curation seca_bacsu Protein translocase subunit SecA secA div+ BSU35300 protein protein bacsu Bacillus subtilis MLGILNKMFDPTKRTLNRYEKIANDIDAIRGDYENLSDDALKHKTIEFKERLEKGATTDDLLVEAFAVVREASRRVTGMFPFKVQLMGGVALHDGNIAEMKTGEGKTLTSTLPVYLNALTGKGVHVVTVNEYLASRDAEQMGKIFEFLGLTVGLNLNSMSKDEKREAYAADITYSTNNELGFDYLRDNMVLYKEQMVQRPLHFAVIDEVDSILIDEARTPLIISGQAAKSTKLYVQANAFVRTLKAEKDYTYDIKTKAVQLTEEGMTKAEKAFGIDNLFDVKHVALNHHINQALKAHVAMQKDVDYVVEDGQVVIVDSFTGRLMKGRRYSEGLHQAIEAKEGLEIQNESMTLATITFQNYFRMYEKLAGMTGTAKTEEEEFRNIYNMQVVTIPTNRPVVRDDRPDLIYRTMEGKFKAVAEDVAQRYMTGQPVLVGTVAVETSELISKLLKNKGIPHQVLNAKNHEREAQIIEEAGQKGAVTIATNMAGRGTDIKLGEGVKELGGLAVVGTERHESRRIDNQLRGRSGRQGDPGITQFYLSMEDELMRRFGAERTMAMLDRFGMDDSTPIQSKMVSRAVESSQKRVEGNNFDSRKQLLQYDDVLRQQREVIYKQRFEVIDSENLREIVENMIKSSLERAIAAYTPREELPEEWKLDGLVDLINTTYLDEGALEKSDIFGKEPDEMLELIMDRIITKYNEKEEQFGKEQMREFEKVIVLRAVDSKWMDHIDAMDQLRQGIHLRAYAQTNPLREYQMEGFAMFEHMIESIEDEVAKFVMKAEIENNLEREEVVQGQTTAHQPQEGDDNKKAKKAPVRKVVDIGRNAPCHCGSGKKYKNCCGRTE 9AAC3630139F5EFF mint sece_aquae Protein translocase subunit SecE secE aq_1930 protein protein aquae Aquifex aeolicus (strain VF5) MEKLKEFLKGVRDELKRVVWPSRELVVKATISVIIFSLAIGVYLWILDLTFTKIISFILSLRGSL 4571C9039CF613DF secg_aquae Protein-export membrane protein SecG secG aq_098 protein protein aquae Aquifex aeolicus (strain VF5) MYYALLTLFVIIAVVLIISTLLQKGRGDVGAAFGGGMGQSIFGVGGVETILTKATYWLGALFLVLALLLSVIPKEKGSVVEKSVQTEQSEGKGTTQESGK C7183A51B27FA21A secy_aquae Protein translocase subunit SecY secY aq_079 protein protein aquae Aquifex aeolicus (strain VF5) MSEYLKALFELKELRQKFIFTLLMFVIYRLGSHIPIPGINPEALRDFLKAFEGSVFALYDIFSGGNLGRLTVFALGVMPYISASIMMQLLTVAIPSLQRLAKEEGDYGRYKINEYTKYLTLFVATVQSLGIAFWIRGQVSPKGIPVVENPGISFILITVLTLVAGTMFLVWIADRITEKGIGNGASLIIFAGIVANFPNAVIQFYEKVKTGDIGPLTLLLIIALIIAIIVGIVYVQEAERRIPIQYPGRQVGRQLYAGRKTYLPIKINPAGVIPIIFAQALLLIPSTLLNFVQNPFIKVIADMFQPGAIFYNFLYVTFIVFFTYFYTAVLINPVELAENLHKAGAFIPGVRPGQDTVKYLERIINRLIFFGALFLSVIALIPILISVWFNIPFYFGGTTALIVVGVALDTFRQIETYLIQKKYKSYVRR 87D4FC133D037C25 sece_thema Protein translocase subunit SecE secE TM_0452 protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MEKLRKFFREVIAEAKKISWPSRKELLTSFGVVLVILAVTSVYFFVLDFIFSGVVSAIFKALGIG A9EAC82A8E92947A secy_thema Protein translocase subunit SecY secY TM_1480 protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MWQAFKNAFKIPELRDRIIFTFLALIVFRMGIYIPVPGLNLEAWGEIFRRIAETAGVAGILSFYDVFTGGALSRFSVFTMSVTPYITASIILQLLASVMPSLKEMLREGEEGRKKFAKYTRRLTLLIGGFQAFFVSFSLARSNPDMVAPGVNVLQFTVLSTMSMLAGTMFLLWLGERITEKGIGNGISILIFAGIVARYPSYIRQAYLGGLNLLEWIFLIAVALITIFGIILVQQAERRITIQYARRVTGRRVYGGASTYLPIKVNQGGVIPIIFASAIVSIPSAIASITNNETLKNLFRAGGFLYLLIYGLLVFFFTYFYSVVIFDPREISENIRKYGGYIPGLRPGRSTEQYLHRVLNRVTFIGAVFLVVIALLPYLVQGAIKVNVWIGGTSALIAVGVALDIIQQMETHMVMRHYEGFIKKGKIRGRR 0FFDBBAD1F8F0B61 a0a0f6ak20_thesq Protein-export membrane protein SecG TRQ2_0456 protein protein thesq thesq MKTFFLIVHTIISVALIYMVQVQMSKFSELGGAFGSGGLHTVFGRRKGLDTGGKITLVLSVLFFVSCVVTAFVLTR seca_thema Protein translocase subunit SecA secA TM_1578 protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MILFDKNKRILKKYAKMVSKINQIESDLRSKKNSELIRLSMVLKEKVNSFEDADEHLFEAFALVREAARRTLGMRPFDVQVMGGIALHEGKVAEMKTGEGKTLAATMPIYLNALIGKGVHLVTVNDYLARRDALWMGPVYLFLGLRVGVINSLGKSYEVVWKNPDLARKAIEENWSVWPDGFNGEVLKEESMNKEAVEAFQVELKEITRKEAYLCDVTYGTNNEFGFDYLRDNLVLDYNDKVQRGHFYAIVDEADSVLIDEARTPLIISGPSKESPSVYRRFAQIAKKFVKDKDFTVDEKARTIILTEEGVAKAEKIIGVENLYDPGNVSLLYHLINALKALHLFKKDVDYVVMNGEVIIVDEFTGRLLPGRRYSGGLHQAIEAKEGVPIKEESITYATITFQNYFRMYEKLAGMTGTAKTEESEFVQVYGMEVVVIPTHKPMIRKDHDDLVFRTQKEKYEKIVEEIEKRYKKGQPVLVGTTSIEKSELLSSMLKKKGIPHQVLNAKYHEKEAEIVAKAGQKGMVTIATNMAGRGTDIKLGPGVAELGGLCIIGTERHESRRIDNQLRGRAGRQGDPGESIFFLSLEDDLLRIFGSEQIGKVMNILKIEEGQPIQHPMLSKLIENIQKKVEGINFSIRKTLMEMDDVLDKQRRAVYSLRDQILLEKDYDEYLKDIFEDVVSTRVEEFCSGKNWDIESLKNSLSFFPAGLFDLDEKQFSSSEELHDYLFNRLWEEYQRKKQEIGEDYRKVIRFLMLRIIDDHWRRYLEEVEHVKEAVQLRSYGQKDPIVEFKKETYYMFDEMMRRINDTIANYVLRVVKVSEKDEKEAKEELGKIRLVHEEFNLVNRAMRRATEKKKKKDGLHSFGRIRVKR 24F661A1799AC89C aasece-aasecg-1 3293963 N/A 3293970 unspecified role unspecified role unspecified role unspecified role Region 2-780 Region 2-780 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3293971 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3293972 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3293973 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false tmsece-tmsecy-1 3293964 N/A 3293974 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3293975 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false tmseca-tmsece-1 3293965 N/A 3293976 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3293977 unspecified role unspecified role unspecified role unspecified role Region 1-816 Region 1-816 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3293974 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3293975 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false aasece-aasecg-2 3293966 N/A 3293970 unspecified role unspecified role unspecified role unspecified role Region 2-780 Region 2-780 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3293971 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3293972 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3293973 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false tmsece-tmsecg-1 3293967 N/A 3293976 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3293974 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3293975 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false bsseca-tmsece-1 3293968 N/A 3293970 unspecified role unspecified role unspecified role unspecified role Region 2-780 Region 2-780 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3293974 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3293975 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false aasece-aasecg-3 3293969 N/A 3293971 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3293972 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3293973 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false