DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dominguez_solis-2008-1 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Dominguez-Solis JR., He Z., Lima A., Ting J., Buchanan BB., Luan S. DIP original experiment: DIP-116172X sluan@nature.berkeley.edu, view@nature.berkeley.edu Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A cyclophilin links redox and light signals to cysteine biosynthesis and stress responses in chloroplasts. Dominguez-Solis JR., He Z., Lima A., Ting J., Buchanan BB., Luan S. Only protein-protein interactions imex curation dominguez_solis-2008-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Dominguez-Solis JR., He Z., Lima A., Ting J., Buchanan BB., Luan S. DIP original experiment: DIP-116173X sluan@nature.berkeley.edu, view@nature.berkeley.edu Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A cyclophilin links redox and light signals to cysteine biosynthesis and stress responses in chloroplasts. Dominguez-Solis JR., He Z., Lima A., Ting J., Buchanan BB., Luan S. Only protein-protein interactions imex curation dominguez_solis-2008-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Dominguez-Solis JR., He Z., Lima A., Ting J., Buchanan BB., Luan S. DIP original experiment: DIP-116174X sluan@nature.berkeley.edu, view@nature.berkeley.edu Arabidopsis cDNA library. Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A cyclophilin links redox and light signals to cysteine biosynthesis and stress responses in chloroplasts. Dominguez-Solis JR., He Z., Lima A., Ting J., Buchanan BB., Luan S. Only protein-protein interactions imex curation dominguez_solis-2008-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Dominguez-Solis JR., He Z., Lima A., Ting J., Buchanan BB., Luan S. DIP original experiment: DIP-133406X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A cyclophilin links redox and light signals to cysteine biosynthesis and stress responses in chloroplasts. Dominguez-Solis JR., He Z., Lima A., Ting J., Buchanan BB., Luan S. Only protein-protein interactions imex curation dominguez_solis-2008-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Dominguez-Solis JR., He Z., Lima A., Ting J., Buchanan BB., Luan S. DIP original experiment: DIP-133407X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A cyclophilin links redox and light signals to cysteine biosynthesis and stress responses in chloroplasts. Dominguez-Solis JR., He Z., Lima A., Ting J., Buchanan BB., Luan S. Only protein-protein interactions imex curation dominguez_solis-2008-6 ecolx Escherichia coli pull down pull down anti tag western anti tag western blot anti tag western Dominguez-Solis JR., He Z., Lima A., Ting J., Buchanan BB., Luan S. DIP original experiment: DIP-133408X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A cyclophilin links redox and light signals to cysteine biosynthesis and stress responses in chloroplasts. Dominguez-Solis JR., He Z., Lima A., Ting J., Buchanan BB., Luan S. Only protein-protein interactions imex curation cp20c_arath Peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic Rotamase cyclophilin-4 Cyclophilin of 20 kDa 3 Cyclosporin A-binding protein CYP20-3 At3g62030 F21F14.200 ROC4 Rotamase CYP20-3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSSSMQMVHTSRSIAQIGFGVKSQLVSANRTTQSVCFGARSSGIALSSRLHYASPIKQFSGVYATTKHQRTACVKSMAAEEEEVIEPQAKVTNKVYFDVEIGGEVAGRIVMGLFGEVVPKTVENFRALCTGEKKYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGPGILSMANAGPNTNGSQFFICTVKTSWLDNKHVVFGQVIEGMKLVRTLESQETRAFDVPKKGCRIYACGELPLDA asat1_arath Acyl-CoA--sterol O-acyltransferase 1 ASAT1 Sterol O-acyltransferase 1 F4F15.80 At3g51970 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASFIKAWGLVIISLCYTFFIAKLVPKGIKRLILFFPVFLIFFIVPFLIYSLHLLGITAFFIAWLANFKLLLFALGRGPLSSNHKPLSLPIFLAVSCLPIKIQLSPKPTKTHSHEGSTEGPLIYTIKAVFVVLIIKAYEYSTKLPEKVVLTLYAIHIYFALEIILAATAAAVRAMSDLELEPQFNKPYLATSLQDFWGRRWNLMVTGILRPTVYEPSLQLFSVLGPNYSQILAAFGTFVVSGIMHELIFFYMGRLRPDWKMMWFFLINGFCTTVEIAIKKTINGRWRFPKAISQVLTLTFVMVTALWLFLPEFNRCNIVEKALDEYAAIGAFAVEVRRKLTAYLF sat1_arath Serine acetyltransferase 1, chloroplastic SAT1 SAT5 F14J16.18 At1g55920 SAT-p AtSERAT2;1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATCIDTCRTGNTQDDDSRFCCIKNFFRPGFSVNRKIHHTQIEDDDDVWIKMLEEAKSDVKQEPILSNYYYASITSHRSLESALAHILSVKLSNLNLPSNTLFELFISVLEESPEIIESTKQDLIAVKERDPACISYVHCFLGFKGFLACQAHRIAHTLWKQNRKIVALLIQNRVSESFAVDIHPGAKIGKGILLDHATGVVIGETAVVGDNVSILHGVTLGGTGKQSGDRHPKIGDGVLIGAGSCILGNITIGEGAKIGSGSVVVKDVPARTTAVGNPARLIGGKENPRKHDKIPCLTMDQTSYLTEWSDYVI cyp20_3-asat1-1 3178366 N/A 3178372 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3178373 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false The paper incorrectly states cyp2-3 is At5g62030 , the correct TAIR locus identifier is At3g62030. Figure 3B 0.0 cyp20_3-asat1-2 3178367 N/A 3178373 unspecified role unspecified role prey prey N/A 3178372 unspecified role unspecified role bait bait physical association physical association false false false The paper incorrectly states cyp2-3 is At5g62030 , the correct TAIR locus identifier is At3g62030. Figure 3A 0.0 cyp20_3-asat1-3 3178368 N/A 3178373 unspecified role unspecified role prey prey N/A 3178372 unspecified role unspecified role bait bait physical association physical association false false false The papaer incorrectly states cyp2-3 is At5g62030 , the correct TAIR locus identifier is At3g62030. 0.0 cyp20_3-sat1-1 3178369 N/A 3178374 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3178372 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false cyp20_3-sat1-2 3178370 N/A 3178374 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3178372 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false cyp20_3-sat1-3 3178371 N/A 3178374 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3178372 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false