DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ boukerche-2008-1 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Boukerche H., Su ZZ., Prévot C., Sarkar D., Fisher PB. DIP original experiment: DIP-113429X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx mda-9/Syntenin promotes metastasis in human melanoma cells by activating c-Src. Boukerche H., Su ZZ., Prévot C., Sarkar D., Fisher PB. Only protein-protein interactions imex curation boukerche-2008-2 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Boukerche H., Su ZZ., Prévot C., Sarkar D., Fisher PB. DIP original experiment: DIP-113430X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx mda-9/Syntenin promotes metastasis in human melanoma cells by activating c-Src. Boukerche H., Su ZZ., Prévot C., Sarkar D., Fisher PB. Only protein-protein interactions imex curation src_human Proto-oncogene tyrosine-protein kinase Src pp60c-src SRC SRC1 Proto-oncogene c-Src protein protein human Homo sapiens Human MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL sdcb1_human Syntenin-1 Scaffold protein Pbp1 Pro-TGF-alpha cytoplasmic domain-interacting protein 18 Syndecan-binding protein 1 Melanoma differentiation-associated protein 9 SDCBP MDA9 SYCL protein protein human Homo sapiens Human MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV sdcbp-src-1 3178070 N/A 3178072 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3178073 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false src-sdcbp-1 3178071 N/A 3178073 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3178072 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false