DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ song-2008-17 ecolx Escherichia coli nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Song J., McGivern JV., Nichols KW., Markley JL., Sheets MD. DIP original experiment: DIP-113417X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Structural basis for RNA recognition by a type II poly(A)-binding protein. Song J., McGivern JV., Nichols KW., Markley JL., Sheets MD. Only protein-protein interactions imex curation song-2008-18 in vitro In vitro crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Song J., McGivern JV., Nichols KW., Markley JL., Sheets MD. DIP original experiment: DIP-113418X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Structural basis for RNA recognition by a type II poly(A)-binding protein. Song J., McGivern JV., Nichols KW., Markley JL., Sheets MD. Only protein-protein interactions imex curation song-2008-19 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Song J., McGivern JV., Nichols KW., Markley JL., Sheets MD. DIP original experiment: DIP-113419X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Structural basis for RNA recognition by a type II poly(A)-binding protein. Song J., McGivern JV., Nichols KW., Markley JL., Sheets MD. Only protein-protein interactions imex curation epa2a_xenla Embryonic polyadenylate-binding protein 2-A Pabpn1l-a epabp2-a pabpnl1-a Embryonic poly(A)-binding protein type II-A PABPN2 p32 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSERVSEEPGLDKGDGAEECELDDPELKAIRMRVREMEEEAERLKGLSGQDKSIGVSPRPCMKLIHSKMTAGEYTEGPPRPLSAEEKKEIDKRSVYVGNVDYGGTAQDLEAHFSSCGSINRITILCDKFSGHPKGYAYIEFAERNSVDAAVTMDETVFRGRTIKVLPKRTNMPGISSTDRGGFRGRPRGNRGNYQRGQRPRGRPFRGCGRPGPLNHPY pabpn1l_a-1 3177980 N/A 3177983 unspecified role unspecified role unspecified role unspecified role Region 60-180 Region 60-180 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false pabpn1l_a-2 3177981 N/A 3177983 unspecified role unspecified role unspecified role unspecified role Region 60-180 Region 60-180 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false pabpn1l_a-3 3177982 N/A 3177983 unspecified role unspecified role unspecified role unspecified role Region 60-180 Region 60-180 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false