DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ buhr-2008-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Buhr F., El Bakkouri M., Valdez O., Pollmann S., Lebedev N., Reinbothe S., Reinbothe C. DIP original experiment: DIP-113343X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Photoprotective role of NADPH:protochlorophyllide oxidoreductase A. Buhr F., El Bakkouri M., Valdez O., Pollmann S., Lebedev N., Reinbothe S., Reinbothe C. Only protein-protein interactions imex curation buhr-2008-2 in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Buhr F., El Bakkouri M., Valdez O., Pollmann S., Lebedev N., Reinbothe S., Reinbothe C. DIP original experiment: DIP-113344X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Photoprotective role of NADPH:protochlorophyllide oxidoreductase A. Buhr F., El Bakkouri M., Valdez O., Pollmann S., Lebedev N., Reinbothe S., Reinbothe C. Only protein-protein interactions imex curation porb_horvu Protochlorophyllide reductase B, chloroplastic PORB NADPH-protochlorophyllide oxidoreductase B protein protein horvu Hordeum vulgare (Barley) Barley MALQAATSFLPSALSARKEGAAKDSAFFGVRLADGLKLDATSLGLRTKRVNTSSVAIRAQAAAVSAPTATPASPAGKKTVRTGNAIITGASSGLGLATAKALAESGKWHVIMACRDYLKTARAARAAGMPKGSYTIVHLDLASLDSVRQFVKNVRQLDMPIDVVVCNAAVYQPTAKEPSFTADGFEMSVGVNHLGHFLLARELLEDLKASDYPSKRLIIVGSITGNTNTLAGNVPPKANLGDLRGLAAGLNGVGSAAMIDGAEFDGAKAYKDSKVCNMLTMQEFHRRYHEETGVTFASLYPGCIATTGLFREHIPLFRLLFPPFQKYITKGYVSEEEAGKRLAQVVSEPSLTKSGVYWSWNKNSASFENQLSEEASDTEKARKVWELSEKLVGLA pora_horvu Protochlorophyllide reductase A, chloroplastic PORA NADPH-protochlorophyllide oxidoreductase A protein protein horvu Hordeum vulgare (Barley) Barley MALQLLPSTLSVPKKGSSMGAVAVKDTAAFLGVSSKAKKASLAVRTQVATAPSPVTTSPGSTASSPSGKKTLRQGVVVITGASSGLGLAAAKALAETGKWHVVMACRDFLKASKAAKAAGMADGSYTVMHLDLASLDSVRQFVDAFRRAEMPLDVLVCNAAIYRPTARTPTFTADGHEMSVGVNHLGHFLLARLLMEDLQKSDYPSRRMVIVGSITGNSNTLAGNVPPKASLGDLRGLAGGLSGASGSAMIDGDESFDGAKAYKDSKVCNMLTMQEFHRRYHEETGITFSSLYPGCIATTGLFREHIPLFRTLFPPFQKFVTKGFVSEAESGKRLAQVVAEPVLTKSGVYWSWNKDSASFENQLSQEASDPEKARKVWELSEKLVGLA pora-porb-3 3176658 N/A 3176660 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3176661 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false pora-porb-4 3176659 N/A 3176660 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3176661 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false