DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wang-2008-50 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Wang L., Gilbert RJ., Atilano ML., Filipe SR., Gay NJ., Ligoxygakis P. DIP original experiment: DIP-260427X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Peptidoglycan recognition protein-SD provides versatility of receptor formation in Drosophila immunity. Wang L., Gilbert RJ., Atilano ML., Filipe SR., Gay NJ., Ligoxygakis P. Only protein-protein interactions imex curation wang-2008-51 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Wang L., Gilbert RJ., Atilano ML., Filipe SR., Gay NJ., Ligoxygakis P. DIP original experiment: DIP-260430X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Peptidoglycan recognition protein-SD provides versatility of receptor formation in Drosophila immunity. Wang L., Gilbert RJ., Atilano ML., Filipe SR., Gay NJ., Ligoxygakis P. Only protein-protein interactions imex curation wang-2008-52 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Wang L., Gilbert RJ., Atilano ML., Filipe SR., Gay NJ., Ligoxygakis P. DIP original experiment: DIP-260433X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Peptidoglycan recognition protein-SD provides versatility of receptor formation in Drosophila immunity. Wang L., Gilbert RJ., Atilano ML., Filipe SR., Gay NJ., Ligoxygakis P. Only protein-protein interactions imex curation wang-2008-53 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Wang L., Gilbert RJ., Atilano ML., Filipe SR., Gay NJ., Ligoxygakis P. DIP original experiment: DIP-260428X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Peptidoglycan recognition protein-SD provides versatility of receptor formation in Drosophila immunity. Wang L., Gilbert RJ., Atilano ML., Filipe SR., Gay NJ., Ligoxygakis P. Only protein-protein interactions imex curation wang-2008-54 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Wang L., Gilbert RJ., Atilano ML., Filipe SR., Gay NJ., Ligoxygakis P. DIP original experiment: DIP-260431X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Peptidoglycan recognition protein-SD provides versatility of receptor formation in Drosophila immunity. Wang L., Gilbert RJ., Atilano ML., Filipe SR., Gay NJ., Ligoxygakis P. Only protein-protein interactions imex curation wang-2008-55 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Wang L., Gilbert RJ., Atilano ML., Filipe SR., Gay NJ., Ligoxygakis P. DIP original experiment: DIP-260429X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Peptidoglycan recognition protein-SD provides versatility of receptor formation in Drosophila immunity. Wang L., Gilbert RJ., Atilano ML., Filipe SR., Gay NJ., Ligoxygakis P. Only protein-protein interactions imex curation wang-2008-56 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Wang L., Gilbert RJ., Atilano ML., Filipe SR., Gay NJ., Ligoxygakis P. DIP original experiment: DIP-260432X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Peptidoglycan recognition protein-SD provides versatility of receptor formation in Drosophila immunity. Wang L., Gilbert RJ., Atilano ML., Filipe SR., Gay NJ., Ligoxygakis P. Only protein-protein interactions imex curation pgpsd_drome Peptidoglycan-recognition protein SD PGRP-SD CG7496 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTWIGLLIVGLTAIAVQGEVPIVTRAEWNAKPPNGAIDSMETPLPRAVIAHTAGGACADDVTCSQHMQNLQNFQMSKQKFSDIGYHYLIGGNGKVYEGRSPSQRGAFAGPNNDGSLGIAFIGNFEERAPNKEALDAAKELLEQAVKQAQLVEGYKLLGHRQVSATKSPGEALYALIQQWPNWSEEM gnbp1_drome Gram-negative bacteria-binding protein 1 GNBP1 CG6895 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPGLCIGILLLIGFGCTTAYKIPTPTVELLETGFSVSIPDEEGVKVVAFNVNRNRNFTSFINEGQYNVRLTEPQNGRWTTNFSSVPLRSQDVLYLWTSVQHQKAVYQDLAQPLPVCNLGGEYRPRGCSPGDDDFTDDNQLSTEDSALEPTAPSVCEPSESQVSPQIGVSICKGQLLFEETFDQLNESLWIHDVRLPLDSKDAEFVLYDGKAKVHDGNLVIEPLLWSSYRPDLSIANSRLDLSERCTGTHNRIKECILHSTGSGPSGIMPPIVTPRISTKETFAFQYGRIEIRAKLPKGDWIVPLLLLEPLTEWYGQSGYESGQLRVALARGNSVLRMPRGKLVDGRSLYGGPVLSTDAHQREDLWLSKRKISHFGDDFHTYSLDWSSNRLLFSVDGQVYGEMLNGFTELDENPRWKQGGPMAPFDKMFYISLGVSVGGFGDFVDHLRTATYEKPWANYHPQAKLQFHQAQDQWLPTWKQPALKIDYVRVFATDN pgpsa_drome Peptidoglycan-recognition protein SA PGRP-SA seml CG11709 Protein semmelweis protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQPVRFGSPWIMAIGLVLLLLAFVSAGKSRQRSPANCPTIKLKRQWGGKPSLGLHYQVRPIRYVVIHHTVTGECSGLLKCAEILQNMQAYHQNELDFNDISYNFLIGNDGIVYEGTGWGLRGAHTYGYNAIGTGIAFIGNFVDKLPSDAALQAAKDLLACGVQQGELSEDYALIAGSQVISTQSPGLTLYNEIQEWPHWLSNP gnbp1-pgrp_sd-1 3175853 N/A 3175860 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3175861 unspecified role unspecified role bait bait spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false pgrp_sa-gnbp1-1 3175854 N/A 3175862 unspecified role unspecified role bait bait spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3175861 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false gnbp1-pgrp_sa-1 3175855 N/A 3175860 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3175862 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3175861 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false pgrp_sd-gnbp1-1 3175856 N/A 3175860 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3175861 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false gnbp1-pgrp_sd-2 3175857 N/A 3175860 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3175861 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false gnbp1-pgrp_sa-2 3175858 N/A 3175862 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3175861 unspecified role unspecified role bait bait spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false gnbp1-pgrp_sa-3 3175859 N/A 3175862 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3175861 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false