DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ baek-2008-1 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Baek K., Liu X., Ferron F., Shu S., Korn ED., Dominguez R. DIP original experiment: DIP-113276X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Modulation of actin structure and function by phosphorylation of Tyr-53 and profilin binding. Baek K., Liu X., Ferron F., Shu S., Korn ED., Dominguez R. Only protein-protein interactions imex curation baek-2008-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Baek K., Liu X., Ferron F., Shu S., Korn ED., Dominguez R. DIP original experiment: DIP-113274X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Modulation of actin structure and function by phosphorylation of Tyr-53 and profilin binding. Baek K., Liu X., Ferron F., Shu S., Korn ED., Dominguez R. Only protein-protein interactions imex curation baek-2008-3 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Baek K., Liu X., Ferron F., Shu S., Korn ED., Dominguez R. DIP original experiment: DIP-113277X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Modulation of actin structure and function by phosphorylation of Tyr-53 and profilin binding. Baek K., Liu X., Ferron F., Shu S., Korn ED., Dominguez R. Only protein-protein interactions imex curation baek-2008-4 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Baek K., Liu X., Ferron F., Shu S., Korn ED., Dominguez R. DIP original experiment: DIP-113275X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Modulation of actin structure and function by phosphorylation of Tyr-53 and profilin binding. Baek K., Liu X., Ferron F., Shu S., Korn ED., Dominguez R. Only protein-protein interactions imex curation baek-2008-5 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Baek K., Liu X., Ferron F., Shu S., Korn ED., Dominguez R. DIP original experiment: DIP-113278X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Modulation of actin structure and function by phosphorylation of Tyr-53 and profilin binding. Baek K., Liu X., Ferron F., Shu S., Korn ED., Dominguez R. Only protein-protein interactions imex curation baek-2008-6 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Baek K., Liu X., Ferron F., Shu S., Korn ED., Dominguez R. DIP original experiment: DIP-250061X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Modulation of actin structure and function by phosphorylation of Tyr-53 and profilin binding. Baek K., Liu X., Ferron F., Shu S., Korn ED., Dominguez R. Only protein-protein interactions imex curation baek-2008-7 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Baek K., Liu X., Ferron F., Shu S., Korn ED., Dominguez R. DIP original experiment: DIP-250062X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Modulation of actin structure and function by phosphorylation of Tyr-53 and profilin binding. Baek K., Liu X., Ferron F., Shu S., Korn ED., Dominguez R. Only protein-protein interactions imex curation act1_dicdi Major actin act1 act2 act4 act5 act6 act7 act8 act9 act11 Actin A1 Actin III Actin-3a Actin-16 Actin M6 Actin-19 Actin-20 Actin-21 DDB_G0289553 DDB_G0274133 DDB_G0289005 DDB_G0289663 DDB_G0274135 DDB_G0280545 DDB_G0269234 DDB_G0274601 DDB_G0288879 DDB_G0274129 DDB_G0274599 DDB_G0274137 DDB_G0272520 DDB_G0272248 DDB_G0274727 DDB_G0274285 DDB_G0274561 act12 act13 act14 act15 act16 act19 act20 act21 act1a act2-1 actA8 actB1 actA1 actM6 Actin-1 Actin-2 Actin-2-sub 1 Actin-4 Actin-5 Actin-6 Actin-7 Actin-8 Actin A8 Actin-IEL1 Actin-9 Actin-11 Actin-12 Actin A12 Actin-13 Actin-14 Actin-15 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MDGEDVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEAEMQTAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF mint Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. Multiple isoforms are involved in various cellular functions such as cytoskeleton structure, cell mobility, chromosome movement and muscle contraction prof1_human Profilin-1 Profilin I PFN1 Epididymis tissue protein Li 184a protein protein human Homo sapiens Human MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY gels_human Gelsolin GSN Actin-depolymerizing factor Brevin AGEL protein protein human Homo sapiens Human MAPHRPAPALLCALSLALCALSLPVRAATASRGASQAGAPQGRVPEARPNSMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGLGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA vasp_human Vasodilator-stimulated phosphoprotein VASP protein protein human Homo sapiens Human MSETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQVVINCAIVRGVKYNQATPNFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALEGGGPPPPPALPTWSVPNGPSPEEVEQQKRQQPGPSEHIERRVSNAGGPPAPPAGGPPPPPGPPPPPGPPPPPGLPPSGVPAAAHGAGGGPPPAPPLPAAQGPGGGGAGAPGLAAAIAGAKLRKVSKQEEASGGPTAPKAESGRSGGGGLMEEMNAMLARRRKATQVGEKTPKDESANQEEPEARVPAQSESVRRPWEKNSTTLPRMKSSSSVTTSETQPCTPSSSDYSDLQRVKQELLEEVKKELQKVKEEIIEAFVQELRKRGSP act1-pfn1-1 3175710 N/A 3175717 unspecified role unspecified role unspecified role unspecified role dicdi Dictyostelium discoideum (Slime mold) Slime mold N/A 3175718 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false act1-gsn-1 3175711 N/A 3175717 unspecified role unspecified role unspecified role unspecified role dicdi Dictyostelium discoideum (Slime mold) Slime mold N/A 3175719 unspecified role unspecified role unspecified role unspecified role Region 52-176 Region 52-176 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false act1-gsn-2 3175712 N/A 3175717 unspecified role unspecified role unspecified role unspecified role dicdi Dictyostelium discoideum (Slime mold) Slime mold N/A 3175719 unspecified role unspecified role unspecified role unspecified role Region 52-176 Region 52-176 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false act1-pfn1-2 3175713 N/A 3175717 unspecified role unspecified role unspecified role unspecified role dicdi Dictyostelium discoideum (Slime mold) Slime mold N/A 3175720 unspecified role unspecified role unspecified role unspecified role Region 198-213 Region 198-213 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3175718 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false act1-pfn1-3 3175714 N/A 3175717 unspecified role unspecified role unspecified role unspecified role dicdi Dictyostelium discoideum (Slime mold) Slime mold N/A 3175718 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false act1-gsn-3 3175715 N/A 3175717 unspecified role unspecified role unspecified role unspecified role dicdi Dictyostelium discoideum (Slime mold) Slime mold N/A 3175719 unspecified role unspecified role unspecified role unspecified role Region 52-176 Region 52-176 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false 1 nodeMerge04 2012-11-04 act1-gsn-4 3175716 N/A 3175717 unspecified role unspecified role unspecified role unspecified role dicdi Dictyostelium discoideum (Slime mold) Slime mold N/A 3175719 unspecified role unspecified role unspecified role unspecified role Region 52-176 Region 52-176 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false 1 nodeMerge04 2012-11-04