DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ de-2008-13 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined de Bruin RA., Kalashnikova TI., Aslanian A., Wohlschlegel J., Chahwan C., Yates JR., Russell P., Wittenberg C. DIP original experiment: DIP-111296X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx DNA replication checkpoint promotes G1-S transcription by inactivating the MBF repressor Nrm1. de Bruin RA., Kalashnikova TI., Aslanian A., Wohlschlegel J., Chahwan C., Yates JR., Russell P., Wittenberg C. Only protein-protein interactions imex curation de-2008-14 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western de Bruin RA., Kalashnikova TI., Aslanian A., Wohlschlegel J., Chahwan C., Yates JR., Russell P., Wittenberg C. DIP original experiment: DIP-111294X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx DNA replication checkpoint promotes G1-S transcription by inactivating the MBF repressor Nrm1. de Bruin RA., Kalashnikova TI., Aslanian A., Wohlschlegel J., Chahwan C., Yates JR., Russell P., Wittenberg C. Only protein-protein interactions imex curation de-2008-15 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western de Bruin RA., Kalashnikova TI., Aslanian A., Wohlschlegel J., Chahwan C., Yates JR., Russell P., Wittenberg C. DIP original experiment: DIP-111295X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx SIF S2 de Bruin RA., Kalashnikova TI., Aslanian A., Wohlschlegel J., Chahwan C., Yates JR., Russell P., Wittenberg C. Only protein-protein interactions imex curation de-2008-16 in vitro In vitro protein kinase assay protein kinase assay autoradiography autoradiography de Bruin RA., Kalashnikova TI., Aslanian A., Wohlschlegel J., Chahwan C., Yates JR., Russell P., Wittenberg C. DIP original experiment: DIP-111297X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx DNA replication checkpoint promotes G1-S transcription by inactivating the MBF repressor Nrm1. de Bruin RA., Kalashnikova TI., Aslanian A., Wohlschlegel J., Chahwan C., Yates JR., Russell P., Wittenberg C. Only protein-protein interactions imex curation de-2008-17 in vitro In vitro pull down pull down predetermined predetermined participant predetermined de Bruin RA., Kalashnikova TI., Aslanian A., Wohlschlegel J., Chahwan C., Yates JR., Russell P., Wittenberg C. DIP original experiment: DIP-111298X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx DNA replication checkpoint promotes G1-S transcription by inactivating the MBF repressor Nrm1. de Bruin RA., Kalashnikova TI., Aslanian A., Wohlschlegel J., Chahwan C., Yates JR., Russell P., Wittenberg C. Only protein-protein interactions imex curation res2_schpo Cell division cycle-related protein res2/pct1 res2 pct1 SPAC22F3.09c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAPRSSAVHVAVYSGVEVYECFIKGVSVMRRRRDSWLNATQILKVADFDKPQRTRVLERQVQIGAHEKVQGGYGKYQGTWVPFQRGVDLATKYKVDGIMSPILSLDIDEGKAIAPKKKQTKQKKPSVRGRRGRKPSSLSSSTLHSVNEKQPNSSISPTIESSMNKVNLPGAEEQVSATPLPASPNALLSPNDNTIKPVEELGMLEAPLDKYEESLLDFFLHPEEGRIPSFLYSPPPDFQVNSVIDDDGHTSLHWACSMGHIEMIKLLLRANADIGVCNRLSQTPLMRSVIFTNNYDCQTFGQVLELLQSTIYAVDTNGQSIFHHIVQSTSTPSKVAAAKYYLDCILEKLISIQPFENVVRLVNLQDSNGDTSLLIAARNGAMDCVNSLLSYNANPSIPNRQRRTASEYLLEADKKPHSLLQSNSNASHSAFSFSGISPAIISPSCSSHAFVKAIPSISSKFSQLAEEYESQLREKEEDLIRANRLKQDTLNEISRTYQELTFLQKNNPTYSQSMENLIREAQETYQQLSKRLLIWLEARQIFDLERSLKPHTSLSISFPSDFLKKEDGLSLNNDFKKPACNNVTNSDEYEQLINKLTSLQASRKKDTLYIRKLYEELGIDDTVNSYRRLIAMSCGINPEDLSLEILDAVEEALTREK 1159312B63E475E4 nrm1_schpo Transcription factor nrm1 Negative regulator of MBF targets 1 SPBC16A3.07c nrm1 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MDRSMEPLTPSRLNTLGERPTNEVYEYGKGKNVQHLFPITPMQRPLGKENAAPGTISPIAVRSRNVRAVEIADENACEEPVLKIKSVSSTESEEEKESSTEIGEKQEKETHLEPKTPVQTNTNNNHLDDIQCCAKNLRLRLELAMYKVQVNQTFSPLQDLPIVAKTKLHNCPNSEPVTSIWNQRSLSSGKPPSLHLSGNRRLSMGSPTKSIYDQNGLTTPRPIGSDDLTHMYDPYTSPLRTPSRTLSRSSSHYLWVRHGKLTRSVSLLQHKTPRRIRPKSLSKSNSTPLKHLSAQKPNSNYYTGPPTPVSISNTPENIHPSSSEVRRIASHSKQFSDYGLIR 783CD47C85CD9D75 cdc10_schpo Start control protein cdc10 cdc10 SPBC336.12c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MASANFIRQFELGNDSFSYQKRPEDEPSQPLSNRNINKLNDSSTLKDSSSRIFINSQVLRDGRPVELYAVECSGMKYMELSCGDNVALRRCPDSYFNISQILRLAGTSSSENAKELDDIIESGDYENVDSKHPQIDGVWVPYDRAISIAKRYGVYEILQPLISFNLDLFPKFSKQQQIESSSISKNLNTSSFNTRSPLRNHNFSNPSKSSKNGVHTINNMQSSPSPSSSFLLPLTQIDSQNVKRSNNYLSTSPPILEQRLKRHRIDVSDEDLHPSSQLNDNEASSLFPDTPRLNHSLSFVSLVSSLPPLDQNIMQDYHTSKDILTSIFLDVNFADSSALEAKLSDSLDLDVPIDELGHAALHWAAAVAKMPLLQALIHKGANPLRGNLTGETALMRSVLVTNHLNQNSFGDLLDLLYASLPCTDRAGRTVVHHICLTAGIKGRGSASRYYLETLLNWAKKHASGNNGYMLKDFINYLNHQDKNGDTALNIAARIGNKNIVEVLMQAGASAYIPNRAGLSVANFGIFVENALKQPEDSKQTKVSLMSENLSSKEKTAVPPRQKSRDIIASVTDVISSLDKDFQDEMAAKQSMIDSAYTQLRESTKKLSDLREQLHVSETQRTLFLELRQRCKNLMTSIEEQKSELSNLYESFDPNGIHDSLSLDADAPFTVNENNNKNLSIAELKFQVAAYERNEARLNELANKLWQRNSNIKSKCRRVVSLCTGVDESRVDSLLESLLQAVESDGQQGEVDMGRVAGFLRVVKEHQA 0E514EE1BE218EFA cds1_schpo Serine/threonine-protein kinase cds1 cds1 Checkpoint kinase cds1 SPCC18B5.11c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEEPEEATQATQEAPLHVSQNIAKQVVNNENVFMKLVMTRMLDGKTEVIPLTTDVHNGFWRFGRHKSCEVVLNGPRVSNFHFEIYQGHRNDSDESENVVFLHDHSSNGTFLNFERLAKNSRTILSNGDEIRIGLGVPKDEISFLCQVPVKHSRDSQKNMIKSENSHYEIIRTLGSGTFAVVKLAVEVNSGKWYAIKIINKRKILLTSSEKRATEMFQREIDILKSLHHPGVVQCHEIFENDDELFIVMEYVEGGDLMDFLIANGSIDEQDCKPLLKQLLETLLHLHKQGVTHRDIKPENILITNDFHLKISDFGLAKVIHGTGTFLETFCGTMGYLAPEVLKSKNVNLDGGYDDKVDIWSLGCVLYVMLTASIPFASSSQAKCIELISKGAYPIEPLLENEISEEGIDLINRMLEINPEKRISESEALQHPWFYTVSTHEHRTPPSSSEHEATEQLNSSS not sure about protein origin 4CEB963D3376DB54 res2-nrm1-1 3175644 N/A 3175649 unspecified role unspecified role bait bait myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3175650 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false nrm1-cdc10-1 3175645 N/A 3175651 unspecified role unspecified role prey prey myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3175650 unspecified role unspecified role bait bait Ha tag Ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false nrm1-res2-1 3175646 N/A 3175649 unspecified role unspecified role prey prey myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3175650 unspecified role unspecified role bait bait Ha tag Ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false cds1-nrm1-1 3175647 N/A 3175652 enzyme enzyme unspecified role unspecified role GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3175650 enzyme target enzyme target substrate substrate unspecified role unspecified role schpm Schizosaccharomyces pombe (fission yeast) Fission yeast direct interaction direct interaction false false false cds1-nrm1-2 3175648 N/A 3175652 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3175650 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast direct interaction direct interaction false false false