DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ demirci-2008-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Demirci H., Gregory ST., Dahlberg AE., Jogl G. DIP original experiment: DIP-110790X Structure (London, England : 1993) 2008 IMEx Multiple-site trimethylation of ribosomal protein L11 by the PrmA methyltransferase. Demirci H., Gregory ST., Dahlberg AE., Jogl G. Only protein-protein interactions imex curation demirci-2008-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Demirci H., Gregory ST., Dahlberg AE., Jogl G. DIP original experiment: DIP-110791X Structure (London, England : 1993) 2008 IMEx Multiple-site trimethylation of ribosomal protein L11 by the PrmA methyltransferase. Demirci H., Gregory ST., Dahlberg AE., Jogl G. Only protein-protein interactions imex curation prma_thet8 Ribosomal protein L11 methyltransferase prmA TTHA0656 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MWVYRLKGTLEALDPILPGLFDGGARGLWEREGEVWAFFPAPVDLPYEGVWEEVGDEDWLEAWRRDLKPALAPPFVVLAPWHTWEGAEIPLVIEPGMAFGTGHHETTRLALKALARHLRPGDKVLDLGTGSGVLAIAAEKLGGKALGVDIDPMVLPQAEANAKRNGVRPRFLEGSLEAALPFGPFDLLVANLYAELHAALAPRYREALVPGGRALLTGILKDRAPLVREAMAGAGFRPLEEAAEGEWVLLAYGR mint Methylates ribosomal protein L11; this reaction probably occurs before the protein is assembled into the ribosome. This function is dispensable for growth and thermostability rl11_theth 50S ribosomal protein L11 rplK rpl11 protein protein theth Thermus thermophilus MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA prma-rplk-3 3174335 N/A 3174337 unspecified role unspecified role unspecified role unspecified role Region 1-59 Region 1-59 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3174338 unspecified role unspecified role unspecified role unspecified role Region 1-72 Region 1-72 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false prma-rplk-4 3174336 N/A 3174337 unspecified role unspecified role unspecified role unspecified role Region 1-59 Region 1-59 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3174338 unspecified role unspecified role unspecified role unspecified role Region 1-72 Region 1-72 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false