DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zhang-2008-29 arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang W., Ito H., Quint M., Huang H., Noël LD., Gray WM. DIP original experiment: DIP-111127X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx f.1 Zhang W., Ito H., Quint M., Huang H., Noël LD., Gray WM. Only protein-protein interactions imex curation zhang-2008-30 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang W., Ito H., Quint M., Huang H., Noël LD., Gray WM. DIP original experiment: DIP-111130X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx f.2 Zhang W., Ito H., Quint M., Huang H., Noël LD., Gray WM. Only protein-protein interactions imex curation zhang-2008-31 arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Zhang W., Ito H., Quint M., Huang H., Noël LD., Gray WM. DIP original experiment: DIP-111132X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx f.2 Zhang W., Ito H., Quint M., Huang H., Noël LD., Gray WM. Only protein-protein interactions imex curation zhang-2008-32 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang W., Ito H., Quint M., Huang H., Noël LD., Gray WM. DIP original experiment: DIP-111128X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx f.1 Zhang W., Ito H., Quint M., Huang H., Noël LD., Gray WM. Only protein-protein interactions imex curation zhang-2008-33 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhang W., Ito H., Quint M., Huang H., Noël LD., Gray WM. DIP original experiment: DIP-111131X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx f.2 Zhang W., Ito H., Quint M., Huang H., Noël LD., Gray WM. Only protein-protein interactions imex curation zhang-2008-34 arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Zhang W., Ito H., Quint M., Huang H., Noël LD., Gray WM. DIP original experiment: DIP-111129X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx f.2 Zhang W., Ito H., Quint M., Huang H., Noël LD., Gray WM. Only protein-protein interactions imex curation cul1_arath Cullin-1 CUL1 At4g02570 T10P11.26 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERKTIDLEQGWDYMQTGITKLKRILEGLNEPAFDSEQYMMLYTTIYNMCTQKPPHDYSQQLYDKYREAFEEYINSTVLPALREKHDEFMLRELFKRWSNHKVMVRWLSRFFYYLDRYFIARRSLPPLNEVGLTCFRDLVYNELHSKVKQAVIALVDKEREGEQIDRALLKNVLDIYVEIGMGQMERYEEDFESFMLQDTSSYYSRKASSWIQEDSCPDYMLKSEECLKKERERVAHYLHSSSEPKLVEKVQHELLVVFASQLLEKEHSGCRALLRDDKVDDLSRMYRLYHKILRGLEPVANIFKQHVTAEGNALVQQAEDTATNQVANTASVQEQVLIRKVIELHDKYMVYVTECFQNHTLFHKALKEAFEIFCNKTVAGSSSAELLATFCDNILKKGGSEKLSDEAIEDTLEKVVKLLAYISDKDLFAEFYRKKLARRLLFDRSANDDHERSILTKLKQQCGGQFTSKMEGMVTDLTLARENQNSFEDYLGSNPAANPGIDLTVTVLTTGFWPSYKSFDINLPSEMIKCVEVFKGFYETKTKHRKLTWIYSLGTCHINGKFDQKAIELIVSTYQAAVLLLFNTTDKLSYTEILAQLNLSHEDLVRLLHSLSCAKYKILLKEPNTKTVSQNDAFEFNSKFTDRMRRIKIPLPPVDERKKVVEDVDKDRRYAIDAAIVRIMKSRKVLGHQQLVSECVEQLSRMFKPDIKAIKKRMEDLITRDYLERDKENPNMFRYLA cand1_arath Cullin-associated NEDD8-dissociated protein 1 At2g02560 CAND1 ETA2 HVE Cullin-associated and neddylation-dissociated protein 1 Protein ENHANCER OF TIR1-1 AUXIN RESISTANCE 2 Protein HEMIVENATA T8K22.14 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MANLQVSGILEKFQMTGKDKDYRYMATSDLLNELNKDSFKIDLDLEVRLSSIILQQLDDVAGDVSGLAVKCLAPLVKKVGEERIVEMTNKLCDKLLHGKDQHRDTASIALRTVVAQIAPTLAPSILVTLTPQMIGGISGQGMSSGIKCECLEIMCDVVQKYGSLMTDDHEKLLNTLLLQLGCNQATVRKKTVTCIASLASSLSDDLLAKATVEVVKNLSNRNAKSEITRTNIQMIGALCRAVGYRFGTHLGNTVPVLINYCTSASENDEELREYSLQALESFLLRCPRDISPYCDEILNLTLEYISYDPNFTDNMEEDTDNETLEDEEDDESANEYTDDEDASWKVRRAAAKCLAGLIVSRSEMLTKVYQEACPKLIDRFKEREENVKMDVFNTFIDLLRQTGNVTKGQTDTDESSPKWLLKQEVSKIVKSINRQLREKSVKTKVGAFSVLRELVVVLPDCLADHIGSLVPGIERALNDKSSTSNLKIEALVFTKLVLASHAPPVFHPYIKALSSPVLAAVGERYYKVTAEALRVCGELVRVVRPSTAGMGFDFKPFVHPIYNAIMSRLTNQDQDQEVKECAITCMGLVISTFGDQLRAELPSCLPVLVDRMGNEITRLTAVKAFSVIATSPLHINLSCVLDHLIAELTGFLRKANRVLRQATLITMNTLVTAYGDKIGSEAYEVILVELSSLISVSDLHMTALALELCCTLMTGKSCSENISLAVRNKVLPQALTLVKSPLLQGQALLDLQKFFEALVYHANTSFYTLLESLLSCAKPSPQSGGVPKQALYSIAQCVAVLCLAAGDKNCSSTVKMLMEILKDDSGTNSAKQHLALLSLGEIGRRKDLSAHAGIETIVIESFQSPFEEIKSAASYALGNIAVGNLSNYLPFILDQIDNQQKKQYILLHSLKEVIVRQSVDKADFQNSSVEKILALLFNHCESEEEGVRNVVAECLGKMALIEPEKLVPALQVRTTSPAAFTRATVVTAVKYSVVERPEKLDEIIFPQISSFLMLIKDGDRHVRRAAVSALSTFAHYKPNLIKGLLPELLPLLYDQTVIKKELIRTVDLGPFKHVVDDGLELRKAAFECVFTLVDSCLDQVNPSSFIVPFLKSGLEDHYDLKMLCHLILSLLADKCPSAVLAVLDSLVEPLHKTISFKPKQDAVKQEHDRNEDMIRSALRAISSLDRINGVDYSHKFKGLMGDMKRSVPLWEKFQTIRNE B0F5769754DE6040 ksg1_arath Shaggy-related protein kinase alpha ASK1 ASK-alpha SK11 Shaggy-related protein kinase 11 F2P16.21 At5g26751 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASVGIAPNPGARDSTGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYNKLNQRMPLIYVKLYTYQIFRALSYIHRCIGVCHRDIKPQNLLVNPHTHQVKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHPFFDELRDPNARLPNGRFLPPLFNFKPHELKGVPLEMVAKLVPEHARKQCPWLGL tir1_arath Protein TRANSPORT INHIBITOR RESPONSE 1 TIR1 FBL1 WEI1 T20O10.80 At3g62980 Weak ethylene-insensitive protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVSPATVIRRFPKVRSVELKGKPHFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRAVPLEKLATLLQRAPQLEELGTGGYTAEVRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYATVQSYDLVKLLCQCPKLQRLWVLDYIEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESVLYFCRQMTNAALITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLSGLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCDSLRKLEIRDCPFGDKALLANASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDERGAPDSRPESCPVERVFIYRTVAGPRFDMPGFVWNMDQDSTMRFSRQIITTNGL iaa7_arath Auxin-responsive protein IAA7 Indoleacetic acid-induced protein 7 Auxin resistant 2 IAA7 AXR2 At3g23050 MXC7.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MIGQLMNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKNVSAVPKEKTTLKDPSKPPAKAQVVGWPPVRNYRKNMMTQQKTSSGAEEASSEKAGNFGGGAAGAGLVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAVGLAPRAMEKYCKNRS cand1-cul1-10 3173068 N/A 3173074 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3173075 unspecified role unspecified role bait bait arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false cul1-ask1-7 3173069 N/A 3173076 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173074 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ask1-cul1-1 3173070 N/A 3173076 unspecified role unspecified role unspecified role unspecified role arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3173077 unspecified role unspecified role unspecified role unspecified role arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3173074 unspecified role unspecified role unspecified role unspecified role arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false cul1-cand1-3 3173071 N/A 3173074 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173075 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false iaa7-cul1-1 3173072 N/A 3173074 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3173078 unspecified role unspecified role bait bait his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false ask1-cand1-1 3173073 N/A 3173076 unspecified role unspecified role unspecified role unspecified role arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3173077 unspecified role unspecified role unspecified role unspecified role arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3173075 unspecified role unspecified role unspecified role unspecified role arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3173074 unspecified role unspecified role unspecified role unspecified role arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false