DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ billen-2008-1 in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Billen LP., Kokoski CL., Lovell JF., Leber B., Andrews DW. DIP original experiment: DIP-110850X PLoS biology 2008 IMEx Bcl-XL inhibits membrane permeabilization by competing with Bax. Billen LP., Kokoski CL., Lovell JF., Leber B., Andrews DW. Only protein-protein interactions imex curation billen-2008-2 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Billen LP., Kokoski CL., Lovell JF., Leber B., Andrews DW. DIP original experiment: DIP-110851X PLoS biology 2008 IMEx Bcl-XL inhibits membrane permeabilization by competing with Bax. Billen LP., Kokoski CL., Lovell JF., Leber B., Andrews DW. Only protein-protein interactions imex curation billen-2008-3 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Billen LP., Kokoski CL., Lovell JF., Leber B., Andrews DW. DIP original experiment: DIP-110852X PLoS biology 2008 IMEx Bcl-XL inhibits membrane permeabilization by competing with Bax. Billen LP., Kokoski CL., Lovell JF., Leber B., Andrews DW. Only protein-protein interactions imex curation bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK bid_mouse BH3-interacting domain death agonist p22 BID Bid protein protein mouse Mus musculus Mouse MDSEVSNGSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD bax-8 3172877 N/A 3172880 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false bcl2l1-bax-6 3172878 N/A 3172880 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3172881 unspecified role unspecified role bait bait Region 4-24 Region 4-24 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q07817-1:p.Tyr101Lys Y101K mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bcl2l1-bid-2 3172879 N/A 3172882 unspecified role unspecified role prey prey P70444:p.[Met97Ala;Asp98Ala] M97A/D98A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3172881 unspecified role unspecified role bait bait Region 4-24 Region 4-24 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false