IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ cao-2008-10 in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Cao W., Xi X., Wang Z., Dong L., Hao Z., Cui L., Ma C., He W., Cao W., Xi X., Wang Z., Dong L., Hao Z., Cui L., Ma C., He W. NKG2D has been entered as being of Human origin, as taken from Ref. 36 and from the abstract statement "All ULBP4 splice variants (ULBP4-I, ULBP4-II and ULBP4-III) were type 1 membrane-spanning molecules and had the ability to bind with human NKG2D receptor in vitro.". heweiimu@public.bta.net.cn International immunology 2008 imex curation Only protein-protein interactions imex curation cao-2008-11 in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Cao W., Xi X., Wang Z., Dong L., Hao Z., Cui L., Ma C., He W., Cao W., Xi X., Wang Z., Dong L., Hao Z., Cui L., Ma C., He W. NKG2D has been entered as being of Human origin, as taken from Ref. 36 and from the abstract statement "All ULBP4 splice variants (ULBP4-I, ULBP4-II and ULBP4-III) were type 1 membrane-spanning molecules and had the ability to bind with human NKG2D receptor in vitro.". heweiimu@public.bta.net.cn International immunology 2008 imex curation Only protein-protein interactions imex curation cao-2008-12 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Cao W., Xi X., Wang Z., Dong L., Hao Z., Cui L., Ma C., He W., Cao W., Xi X., Wang Z., Dong L., Hao Z., Cui L., Ma C., He W. It has been assumed that His-tagged RAET1G2 has been expressed in E.coli, similarly to RAET1G3- although this is not stated. NKG2D has been entered as being of Human origin, as taken from Ref. 36 and from the abstract statement "All ULBP4 splice variants (ULBP4-I, ULBP4-II and ULBP4-III) were type 1 membrane-spanning molecules and had the ability to bind with human NKG2D receptor in vitro.". heweiimu@public.bta.net.cn International immunology 2008 imex curation Only protein-protein interactions imex curation nkg2d_human NKG2-D type II integral membrane protein KLRK1 NKG2D NKG2-D-activating NK receptor NK cell receptor D Killer cell lectin-like receptor subfamily K member 1 D12S2489E protein protein human Homo sapiens Human MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV ulbp3_human UL16-binding protein 3 NKG2D ligand 3 ULBP3 N2DL3 RAET1N ALCAN-gamma Retinoic acid early transcript 1N protein protein human Homo sapiens Human MAAAASPAILPRLAILPYLLFDWSGTGRADAHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEMLREVGQRLRLELADTELEDFTPSGPLTLQVRMSCECEADGYIRGSWQFSFDGRKFLLFDSNNRKWTVVHAGARRMKEKWEKDSGLTTFFKMVSMRDCKSWLRDFLMHRKKRLEPTAPPTMAPGLAQPKAIATTLSPWSFLIILCFILPGI q8td07-2 Retinoic acid early transcript 1E RAET1E LETAL N2DL4 ULBP4 UNQ1867/PRO4303 RL-4 Lymphocyte effector toxicity activation ligand NKG2D ligand 4 RAE-1-like transcript 4 UL16-binding protein 4 ULBP4-II protein protein human Homo sapiens Human MRRISLTSSPVRLLLFLLLLLIALEIMYNSDNNMVKPLGLLGKKVYATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTLQVEMFCQREAERCTGASWQFATNGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLPDRWIILGAFILLVLMGIVLICVWWQNGEWQAGLWPLRTS q8td07-6 Retinoic acid early transcript 1E UNQ1867/PRO4303 ULBP4-I RAET1E LETAL N2DL4 Lymphocyte effector toxicity activation ligand NKG2D ligand 4 RAE-1-like transcript 4 UL16-binding protein 4 ULBP4 protein protein human Homo sapiens Human MRRISLTSSPVRLLLFLLLLLIALEIMVGECPEHKNWLRTRRREKGGHSLCFNFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNMVKPLGLLGKKVYATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTLQVEMFCQREAERCTGASWQFATNGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLPDRWIILGAFILLVLMGIVLICVWWQNGEWQAGLWPLRTS q8td07-5 Retinoic acid early transcript 1E RAET1E LETAL N2DL4 ULBP4 UNQ1867/PRO4303 ULBP4-III Lymphocyte effector toxicity activation ligand NKG2D ligand 4 RAE-1-like transcript 4 UL16-binding protein 4 protein protein human Homo sapiens Human MRRISLTSSPVRLLLFLLLLLIALEIMVGGHSLCFNFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNMVKPLGLLGKKVYATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTLQVEMFCQREAERCTGASWQFATNGEKSLLFDAMNMTWTVINHEAMSPVNASDIHWSSSSLPDRWIILGAFILLVLMGIVLICVWWQNGEWQAGLWPLRTS q8td07-1 Retinoic acid early transcript 1E RAET1E LETAL N2DL4 ULBP4 UNQ1867/PRO4303 ULBP4 RAET1E Lymphocyte effector toxicity activation ligand NKG2D ligand 4 RAE-1-like transcript 4 UL16-binding protein 4 protein protein human Homo sapiens Human MRRISLTSSPVRLLLFLLLLLIALEIMVGGHSLCFNFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNMVKPLGLLGKKVYATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTLQVEMFCQREAERCTGASWQFATNGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLPDRWIILGAFILLVLMGIVLICVWWQNGEWQAGLWPLRTS q6h3x3-3 UL-16 binding protein 5 RAET1G ULBP5 RAET1G3 Retinoic acid early transcript 1G protein protein protein human Homo sapiens Human MAAAASPAFLLRLPLLLLLSSWCRTGLADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGSKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLLDIQLENYIPKENRMWTTVHPGARKMKEKWENDKDMTMSFHYISMGDCTGWLEDFLMGMDSTLEPSAGAPP q6h3x3-2 UL-16 binding protein 5 Retinoic acid early transcript 1G protein ULBP5 RAET1G2 RAET1G protein protein human Homo sapiens Human MAAAASPAFLLRLPLLLLLSSWCRTGLADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGSKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLLDIQLENYIPKEPLTLQARMSCEQKAEGHGSGSWQLSFDGQIFLLFDSENRMWTTVHPGARKMKEKWENDKDMTMSFHYISMGDCTGWLEDFLMGMDSTLEPSAGGTV klrk1-ulbp3-2 3039047 N/A 3039050 unspecified role unspecified role neutral component neutral component partially purified partially purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc N/A 3039051 unspecified role unspecified role neutral component neutral component nucl electroporation nucleic acid electroporation nucl electroporation over-expressed over expressed level over-expressed human-raji Homo sapiens RAJI Burkitt lymphoma cells raji Human Burkitt lymphoma RAJI cells physical association physical association false false false 3A positive control klrk1-ulbp3-3 3039047 N/A 3039050 unspecified role unspecified role neutral component neutral component partially purified partially purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc N/A 3039052 unspecified role unspecified role neutral component neutral component nucl electroporation nucleic acid electroporation nucl electroporation over-expressed over expressed level over-expressed human-raji Homo sapiens RAJI Burkitt lymphoma cells raji Human Burkitt lymphoma RAJI cells physical association physical association false false false 3A-2 Isoform U4-II isoform u4_i-klrk1-2 3039047 N/A 3039050 unspecified role unspecified role neutral component neutral component partially purified partially purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc n/a 3039053 unspecified role unspecified role neutral component neutral component nucl electroporation nucleic acid electroporation nucl electroporation over-expressed over expressed level over-expressed human-raji Homo sapiens RAJI Burkitt lymphoma cells raji Human Burkitt lymphoma RAJI cells physical association physical association false false false 3A-3i Isoform U4-I isoform u4_i-klrk1-4 3039047 N/A 3039050 unspecified role unspecified role neutral component neutral component partially purified partially purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc n/a 3039054 unspecified role unspecified role neutral component neutral component nucl electroporation nucleic acid electroporation nucl electroporation over-expressed over expressed level over-expressed human-raji Homo sapiens RAJI Burkitt lymphoma cells raji Human Burkitt lymphoma RAJI cells physical association physical association false false false 3A-4 Isoform U4-III klrk1-raet1e-6 3039047 N/A 3039050 unspecified role unspecified role neutral component neutral component partially purified partially purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc N/A 3039055 unspecified role unspecified role neutral component neutral component nucl electroporation nucleic acid electroporation nucl electroporation over-expressed over expressed level over-expressed human-raji Homo sapiens RAJI Burkitt lymphoma cells raji Human Burkitt lymphoma RAJI cells physical association physical association false false false 3A-3ii Isoform U4LBP klrk1-raet1e-2 3039048 N/A 3039050 unspecified role unspecified role neutral component neutral component partially purified partially purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc N/A 3039051 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed nucl passive uptake nucleic acid passive uptake nucl passive uptake crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association false false false 3A-1 positive control klrk1-raet1e-3 3039048 N/A 3039050 unspecified role unspecified role neutral component neutral component partially purified partially purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc N/A 3039052 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed nucl passive uptake nucleic acid passive uptake nucl passive uptake crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association false false false 3A-2i Isoform U4-II isoform u4_i-klrk1-1 3039048 N/A 3039050 unspecified role unspecified role neutral component neutral component partially purified partially purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc n/a 3039053 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed nucl passive uptake nucleic acid passive uptake nucl passive uptake crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association false false false 3A-3 Isoform U4-I isoform u4_iii-klrk1-1 3039048 N/A 3039050 unspecified role unspecified role neutral component neutral component partially purified partially purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc n/a 3039054 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed nucl passive uptake nucleic acid passive uptake nucl passive uptake crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association false false false 3A-4i Isoform U4-III klrk1-raet1e-7 3039048 N/A 3039050 unspecified role unspecified role neutral component neutral component partially purified partially purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc N/A 3039055 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed nucl passive uptake nucleic acid passive uptake nucl passive uptake crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association false false false 3A-3ii Isoform U4LBP4 klrk1-raet1g-3 3039049 N/A 3039050 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc N/A 3039056 unspecified role unspecified role prey prey purified purified c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 7A klrk1-isoform raet1g3-2 3039049 N/A 3039050 unspecified role unspecified role bait bait partially purified partially purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc N/A 3039057 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 7Ai positive control