DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ sun-2008-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Sun L., Gao J., Dong X., Liu M., Li D., Shi X., Dong JT., Lu X., Liu C., Zhou J. DIP original experiment: DIP-111002X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx EB1 promotes Aurora-B kinase activity through blocking its inactivation by protein phosphatase 2A. Sun L., Gao J., Dong X., Liu M., Li D., Shi X., Dong JT., Lu X., Liu C., Zhou J. Only protein-protein interactions imex curation sun-2008-7 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Sun L., Gao J., Dong X., Liu M., Li D., Shi X., Dong JT., Lu X., Liu C., Zhou J. DIP original experiment: DIP-111006X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx EB1 promotes Aurora-B kinase activity through blocking its inactivation by protein phosphatase 2A. Sun L., Gao J., Dong X., Liu M., Li D., Shi X., Dong JT., Lu X., Liu C., Zhou J. Only protein-protein interactions imex curation sun-2008-8 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sun L., Gao J., Dong X., Liu M., Li D., Shi X., Dong JT., Lu X., Liu C., Zhou J. DIP original experiment: DIP-111005X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx EB1 promotes Aurora-B kinase activity through blocking its inactivation by protein phosphatase 2A. Sun L., Gao J., Dong X., Liu M., Li D., Shi X., Dong JT., Lu X., Liu C., Zhou J. Only protein-protein interactions imex curation sun-2008-9 human Homo sapiens Human pull down pull down anti tag western anti tag western blot anti tag western Sun L., Gao J., Dong X., Liu M., Li D., Shi X., Dong JT., Lu X., Liu C., Zhou J. DIP original experiment: DIP-111003X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx EB1 promotes Aurora-B kinase activity through blocking its inactivation by protein phosphatase 2A. Sun L., Gao J., Dong X., Liu M., Li D., Shi X., Dong JT., Lu X., Liu C., Zhou J. Only protein-protein interactions imex curation sun-2008-10 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Sun L., Gao J., Dong X., Liu M., Li D., Shi X., Dong JT., Lu X., Liu C., Zhou J. DIP original experiment: DIP-111004X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx EB1 promotes Aurora-B kinase activity through blocking its inactivation by protein phosphatase 2A. Sun L., Gao J., Dong X., Liu M., Li D., Shi X., Dong JT., Lu X., Liu C., Zhou J. Only protein-protein interactions imex curation aurkb_human Aurora kinase B AIRK2 Aurora- and IPL1-like midbody-associated protein 1 Aurora/IPL1-related kinase 2 STK-1 Serine/threonine-protein kinase 12 Serine/threonine-protein kinase 5 STK1 STK5 Aurora 1 AURKB AIK2 AIM1 ARK2 STK12 Serine/threonine-protein kinase aurora-B protein protein human Homo sapiens Human MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEHQLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATIMEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYLPPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGAQDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA mare1_human Microtubule-associated protein RP/EB family member 1 APC-binding protein EB1 End-binding protein 1 MAPRE1 protein protein human Homo sapiens Human MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY mapre1-aurkb-1 3171437 N/A 3171442 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3171443 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false aurkb-mapre1-1 3171438 N/A 3171442 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3171443 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false mapre1-aurkb-2 3171439 N/A 3171442 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3171443 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false mapre1-aurkb-3 3171440 N/A 3171442 unspecified role unspecified role prey prey Ha tag Ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 1-75 binding site 1-75 binding site required to bind necessary binding region required to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false 251-344 binding site 251-344 binding site required to bind necessary binding region required to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3171443 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 209-268 209-268 required to bind necessary binding region required to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false mapre1-aurkb-4 3171441 N/A 3171442 unspecified role unspecified role prey prey Ha tag Ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3171443 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false