DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ yun-2008-1 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yun C., Stanhill A., Yang Y., Zhang Y., Haynes CM., Xu CF., Neubert TA., Mor A., Philips MR., Ron D. DIP original experiment: DIP-110994X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Proteasomal adaptation to environmental stress links resistance to proteotoxicity with longevity in Caenorhabditis elegans. Yun C., Stanhill A., Yang Y., Zhang Y., Haynes CM., Xu CF., Neubert TA., Mor A., Philips MR., Ron D. Only protein-protein interactions imex curation yun-2008-2 human Homo sapiens Human pull down pull down western blot western blot Immuno blot Immuno blot Yun C., Stanhill A., Yang Y., Zhang Y., Haynes CM., Xu CF., Neubert TA., Mor A., Philips MR., Ron D. DIP original experiment: DIP-110997X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Proteasomal adaptation to environmental stress links resistance to proteotoxicity with longevity in Caenorhabditis elegans. Yun C., Stanhill A., Yang Y., Zhang Y., Haynes CM., Xu CF., Neubert TA., Mor A., Philips MR., Ron D. Only protein-protein interactions imex curation yun-2008-3 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yun C., Stanhill A., Yang Y., Zhang Y., Haynes CM., Xu CF., Neubert TA., Mor A., Philips MR., Ron D. DIP original experiment: DIP-110995X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Proteasomal adaptation to environmental stress links resistance to proteotoxicity with longevity in Caenorhabditis elegans. Yun C., Stanhill A., Yang Y., Zhang Y., Haynes CM., Xu CF., Neubert TA., Mor A., Philips MR., Ron D. Only protein-protein interactions imex curation yun-2008-4 human Homo sapiens Human pull down pull down western blot western blot Immuno blot Immuno blot Yun C., Stanhill A., Yang Y., Zhang Y., Haynes CM., Xu CF., Neubert TA., Mor A., Philips MR., Ron D. DIP original experiment: DIP-110998X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Proteasomal adaptation to environmental stress links resistance to proteotoxicity with longevity in Caenorhabditis elegans. Yun C., Stanhill A., Yang Y., Zhang Y., Haynes CM., Xu CF., Neubert TA., Mor A., Philips MR., Ron D. Only protein-protein interactions imex curation yun-2008-5 human Homo sapiens Human pull down pull down western blot western blot Immuno blot Immuno blot Yun C., Stanhill A., Yang Y., Zhang Y., Haynes CM., Xu CF., Neubert TA., Mor A., Philips MR., Ron D. DIP original experiment: DIP-110996X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Proteasomal adaptation to environmental stress links resistance to proteotoxicity with longevity in Caenorhabditis elegans. Yun C., Stanhill A., Yang Y., Zhang Y., Haynes CM., Xu CF., Neubert TA., Mor A., Philips MR., Ron D. Only protein-protein interactions imex curation psa1_mouse Proteasome subunit alpha type-1 Proteasome component C2 Macropain subunit C2 Multicatalytic endopeptidase complex subunit C2 Proteasome nu chain Psma1 protein protein mouse Mus musculus Mouse MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLDELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLDGLEERPQRKAQPSQAAEEPAEKADEPMEH zfn2a_mouse AN1-type zinc finger protein 2A Zfand2a Airap Arsenite-inducible RNA-associated protein protein protein mouse Mus musculus Mouse MEFPDLGKHCSEPTCKQLDFLPITCDACKQDFCKDHFSYVGHKCPFAFKKDVQVPVCPLCNAPIPVKRGEIPDVVVGEHMDRDCTFHPGRNRNKVFTHRCSKEGCRKKEMLQLACAQCHGNFCIQHRHPLDHNCQAGSSSASRGRTSTSRAAEQKPSGVSWLAQRLRRTVK zfn2b_mouse AN1-type zinc finger protein 2B Zfand2b Airapl Arsenite-inducible RNA-associated protein-like protein protein protein mouse Mus musculus Mouse MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAQHHCGSAYQKDIQVPVCPLCNVPVPVARGEPPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERSGCRQREMMKLTCDRCGRNFCIKHRHPLDHECSGEGHQTSRAGLAAISRAQGLASTSTAPSPSRTLPSSSSPSRATPQLPTRTASPVIALQNGLSEDEALQRALELSLAEAKPQVLSSQEEDDLALAQALSASEAEYQQQQAQSRSLKPSNCSLC psa1_human Proteasome subunit alpha type-1 PSMA1 PROS30 PSC2 Proteasome component C2 Macropain subunit C2 Multicatalytic endopeptidase complex subunit C2 Proteasome nu chain 30 kDa prosomal protein HC2 NU protein protein human Homo sapiens Human MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH aal.140 AIRAPL-AIRAP chimera protein protein chemical synthesis Chemical synthesis (Chemical synthesis) TSRAGLAAISRAQGLASTSTAPSPSRTLPSSSSPSRATPQLPTRTASPVIALQNGLSEDEALQRALELSLAEAKPQVLSSQEEDDLALAQALSASEAEYQQQQAQSRSLKPSNCSLCMEFPDLGKHCSEPTCKQLDFLPITCDACKQDFCKDHFSYVGHKCPFAFKKDVQVPVCPLCNAPIPVKRGEIPDVVVGEHMDRDCTFHPGRNRNKVFTHRCSKEGCRKKEMLQLACAQCHGNFCIQHRHPLDHNCQAGSSS psma1-zfand2a-1 3171385 N/A 3171390 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3171391 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3171392 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association false false false zfand2a-psma1-1 3171386 N/A 3171391 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3171393 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false psma1-zfand2b-1 3171387 N/A 3171390 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3171392 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false aal.140-psma1-1 3171388 N/A 3171394 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false human Homo sapiens Human N/A 3171393 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false zfand2b-psma1-1 3171389 N/A 3171393 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3171392 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false