DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kashuba-2008-1 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Kashuba E., Yurchenko M., Yenamandra SP., Snopok B., Isaguliants M., Szekely L., Klein G. DIP original experiment: DIP-68637X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx EBV-encoded EBNA-6 binds and targets MRS18-2 to the nucleus, resulting in the disruption of pRb-E2F1 complexes. Kashuba E., Yurchenko M., Yenamandra SP., Snopok B., Isaguliants M., Szekely L., Klein G. Only protein-protein interactions imex curation kashuba-2008-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kashuba E., Yurchenko M., Yenamandra SP., Snopok B., Isaguliants M., Szekely L., Klein G. DIP original experiment: DIP-68632X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx EBV-encoded EBNA-6 binds and targets MRS18-2 to the nucleus, resulting in the disruption of pRb-E2F1 complexes. Kashuba E., Yurchenko M., Yenamandra SP., Snopok B., Isaguliants M., Szekely L., Klein G. Only protein-protein interactions imex curation kashuba-2008-3 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kashuba E., Yurchenko M., Yenamandra SP., Snopok B., Isaguliants M., Szekely L., Klein G. DIP original experiment: DIP-68635X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx EBV-encoded EBNA-6 binds and targets MRS18-2 to the nucleus, resulting in the disruption of pRb-E2F1 complexes. Kashuba E., Yurchenko M., Yenamandra SP., Snopok B., Isaguliants M., Szekely L., Klein G. Only protein-protein interactions imex curation kashuba-2008-4 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Kashuba E., Yurchenko M., Yenamandra SP., Snopok B., Isaguliants M., Szekely L., Klein G. DIP original experiment: DIP-68633X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx f.1 Kashuba E., Yurchenko M., Yenamandra SP., Snopok B., Isaguliants M., Szekely L., Klein G. Only protein-protein interactions imex curation kashuba-2008-5 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Kashuba E., Yurchenko M., Yenamandra SP., Snopok B., Isaguliants M., Szekely L., Klein G. DIP original experiment: DIP-68638X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx EBV-encoded EBNA-6 binds and targets MRS18-2 to the nucleus, resulting in the disruption of pRb-E2F1 complexes. Kashuba E., Yurchenko M., Yenamandra SP., Snopok B., Isaguliants M., Szekely L., Klein G. Only protein-protein interactions imex curation kashuba-2008-6 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Kashuba E., Yurchenko M., Yenamandra SP., Snopok B., Isaguliants M., Szekely L., Klein G. DIP original experiment: DIP-68636X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx EBV-encoded EBNA-6 binds and targets MRS18-2 to the nucleus, resulting in the disruption of pRb-E2F1 complexes. Kashuba E., Yurchenko M., Yenamandra SP., Snopok B., Isaguliants M., Szekely L., Klein G. Only protein-protein interactions imex curation kashuba-2008-7 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Kashuba E., Yurchenko M., Yenamandra SP., Snopok B., Isaguliants M., Szekely L., Klein G. DIP original experiment: DIP-68634X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx f.1 Kashuba E., Yurchenko M., Yenamandra SP., Snopok B., Isaguliants M., Szekely L., Klein G. Only protein-protein interactions imex curation rb_human Retinoblastoma-associated protein pRb pp110 p105-Rb RB1 p110-RB1 protein protein human Homo sapiens Human MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTALCQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTELQKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSSISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFMNSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKSNLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEK ebna6_ebvb9 Epstein-Barr nuclear antigen 6 EBNA6 Epstein-Barr nuclear antigen 3C Epstein-Barr nuclear antigen 4B BERF3-BERF4 protein protein ebvb9 Epstein-Barr virus (strain B95-8) (HHV-4) Human herpesvirus 4 HHV-4 MESFEGQGDSRQSPDNERGDNVQTTGEHDQDPGPGPPSSGASERLVPEESYSRDQQPWGQSRGDENRGWMQRIRRRRRRRAALSGHLLDTEDNVPPWLPPHDITPYTARNIRDAACRAVKQSHLQALSNLILDSGLDTQHILCFVMAARQRLQDIRRGPLVAEGGVGWRHWLLTSPSQSWPMGYRTATLRTLTPVPNRVGADSIMLTATFGCQNAARTLNTFSATVWTPPHAGPREQERYAREAEVRFLRGKWQRRYRRIYDLIELCGSLHHIWQNLLQTEENLLDFVRFMGVMSSCNNPAVNYWFHKTIGNFKPYYPWNAPPNENPYHARRGIKEHVIQNAFRKAQIQGLSMLATGGEPRGDATSETSSDEDTGRQGSDVELESSDDELPYIDPNMEPVQQRPVMFVSRVPAKKPRKLPWPTPKTHPVKRTNVKTSDRSDKAEAQSTPERPGPSEQSSVTVEPAHPTPVEMPMVILHQPPPVPKPVPVKPTPPPSRRRRGACVVYDDDVIEVIDVETTEDSSSVSQPNKPHRKHQDGFQRSGRRQKRAAPPTVSPSDTGPPAVGPPAAGPPAAGPPAAGPPAAGPPAAGPPAAGPRILAPLSAGPPAAGPHIVTPPSARPRIMAPPVVRMFMRERQLPQSTGRKPQCFWEMRAGREITQMQQEPSSHLQSATQPTTPRPSWAPSVCALSVMDAGKAQPIESSHLSSMSPTQPISHEEQPRYEDPDAPLDLSLHPDVAAQPAPQAPYQGYQEPPAPQAPYQGYQEPPPPQAPYQGYQEPPAHGLQSSSYPGYAGPWTPRSQHPCYRHPWAPWSQDPVHGHTQGPWDPRAPHLPPQWDGSAGHGQDQVSQFPHLQSETGPPRLQLSLVPLVSSSAPSWSSPQPRAPIRPIPTRFPPPPMPLQDSMAVGCDSSGTACPSMPFASDYSQGAFTPLDINATTPKRPRVEESSHGPARCSQATAEAQEILSDNSEISVFPKDAKQTDYDASTESELD rt18b_human 28S ribosomal protein S18b, mitochondrial 28S ribosomal protein S18-2, mitochondrial C6orf14 MRPS18B Mitochondrial small ribosomal subunit protein bS18b Mitochondrial small ribosomal subunit protein mS40 HSPC183 PTD017 protein protein human Homo sapiens Human MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL mrps18b-ebna6-1 3170298 N/A 3170305 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3170306 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3170307 unspecified role unspecified role bait bait ecolx Escherichia coli association association false false false ebna6-mrps18b-1 3170299 N/A 3170307 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3170306 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false mrps18b-ebna6-2 3170300 N/A 3170306 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3170307 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false mrps18b-ebna6-3 3170301 N/A 3170306 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3170307 unspecified role unspecified role bait bait Gst tag Gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false ebna6-mrps18b-2 3170302 N/A 3170306 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3170307 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false mrps18b-rb1-1 3170303 N/A 3170305 unspecified role unspecified role prey prey 380-785 380-785 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3170307 unspecified role unspecified role bait bait Gst tag Gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false ebna6-mrps18b-3 3170304 N/A 3170306 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3170307 unspecified role unspecified role unspecified role unspecified role Gst tag Gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false