DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ danno-2008-1 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Danno H., Michiue T., Hitachi K., Yukita A., Ishiura S., Asashima M. DIP original experiment: DIP-68609X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Molecular links among the causative genes for ocular malformation: Otx2 and Sox2 coregulate Rax expression. Danno H., Michiue T., Hitachi K., Yukita A., Ishiura S., Asashima M. Only protein-protein interactions imex curation danno-2008-2 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Danno H., Michiue T., Hitachi K., Yukita A., Ishiura S., Asashima M. DIP original experiment: DIP-68607X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Molecular links among the causative genes for ocular malformation: Otx2 and Sox2 coregulate Rax expression. Danno H., Michiue T., Hitachi K., Yukita A., Ishiura S., Asashima M. Only protein-protein interactions imex curation danno-2008-3 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Danno H., Michiue T., Hitachi K., Yukita A., Ishiura S., Asashima M. DIP original experiment: DIP-68611X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Molecular links among the causative genes for ocular malformation: Otx2 and Sox2 coregulate Rax expression. Danno H., Michiue T., Hitachi K., Yukita A., Ishiura S., Asashima M. Only protein-protein interactions imex curation danno-2008-4 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Danno H., Michiue T., Hitachi K., Yukita A., Ishiura S., Asashima M. DIP original experiment: DIP-68608X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Molecular links among the causative genes for ocular malformation: Otx2 and Sox2 coregulate Rax expression. Danno H., Michiue T., Hitachi K., Yukita A., Ishiura S., Asashima M. Only protein-protein interactions imex curation danno-2008-5 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Danno H., Michiue T., Hitachi K., Yukita A., Ishiura S., Asashima M. DIP original experiment: DIP-68610X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Molecular links among the causative genes for ocular malformation: Otx2 and Sox2 coregulate Rax expression. Danno H., Michiue T., Hitachi K., Yukita A., Ishiura S., Asashima M. Only protein-protein interactions imex curation sox2_xenla Transcription factor Sox-2 sox2 SRY (sex determining region Y)-box 2 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MYSMMETELKPPAPQQPSGGNSNSASNNQNKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGANAMTSGVGGSLGAGVNQRMDTYAHMNGWTNGGYGMMQEQLGYPQHPGLNAHNAPQMQPMHRYDVSALQYNSMSSSQTYMNGSPTYSMSYSQQGAPGMSLGSMGSVVKSESSSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPESAAQSRLHMSQHYQSASVAGTGINGTLPLSHM otx2a_xenla Homeobox protein OTX2-A otx2-a Orthodenticle 2-A Orthodenticle-A-like protein A protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MMSYLKQPPYAVNGLSLTASGMDLLHQSVGYPATPRKQRRERTTFTRAQLDILEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPSKKKTSPVREVSSESGTSGQFSPPSSTSVPVISSSTAPVSIWSPASVSPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLSPMHHQLSGPGATLSPMGTNAVTSHLNQSPVALSSQAYGASSLGFNSTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL AEB2F2948D51F6D4 otx2-sox2-1 3170108 N/A 3170113 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro N/A 3170114 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 38-100 Region 38-100 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false otx2-sox2-2 3170109 N/A 3170113 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3170114 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false sox2-otx2-1 3170110 N/A 3170113 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 64-114 Region 64-114 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3170114 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro direct interaction direct interaction false false false sox2-otx2-2 3170111 N/A 3170113 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3170114 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false sox2-otx2-3 3170112 N/A 3170113 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 35-114 Region 35-114 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3170114 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro direct interaction direct interaction false false false