DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ huai-2008-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Huai Q., Zhou A., Lin L., Mazar AP., Parry GC., Callahan J., Shaw DE., Furie B., Furie BC., Huang M. DIP original experiment: DIP-113647X Nature structural & molecular biology 2008 IMEx Crystal structures of two human vitronectin, urokinase and urokinase receptor complexes. Huai Q., Zhou A., Lin L., Mazar AP., Parry GC., Callahan J., Shaw DE., Furie B., Furie BC., Huang M. Only protein-protein interactions imex curation huai-2008-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Huai Q., Zhou A., Lin L., Mazar AP., Parry GC., Callahan J., Shaw DE., Furie B., Furie BC., Huang M. DIP original experiment: DIP-113648X Nature structural & molecular biology 2008 IMEx Crystal structures of two human vitronectin, urokinase and urokinase receptor complexes. Huai Q., Zhou A., Lin L., Mazar AP., Parry GC., Callahan J., Shaw DE., Furie B., Furie BC., Huang M. Only protein-protein interactions imex curation q03405-1 Urokinase plasminogen activator surface receptor Monocyte activation antigen Mo3 PLAUR MO3 UPAR uPAR1 GPI-anchored protein protein human Homo sapiens Human MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT urok_human Urokinase-type plasminogen activator PLAU protein protein human Homo sapiens Human MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL vtnc_human Vitronectin VTN Serum-spreading factor V75 S-protein protein protein human Homo sapiens Human MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL plau-plaur-2 3169976 N/A 3169978 unspecified role unspecified role unspecified role unspecified role Region 1-277 Region 1-277 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3169979 unspecified role unspecified role unspecified role unspecified role Region 1-143 Region 1-143 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction false false false plau-plaur-3 3169977 N/A 3169980 unspecified role unspecified role unspecified role unspecified role Region 1-50 Region 1-50 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3169978 unspecified role unspecified role unspecified role unspecified role Region 1-277 Region 1-277 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3169979 unspecified role unspecified role unspecified role unspecified role Region 1-143 Region 1-143 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction false false false