DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ baboolal-2008-1 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Baboolal TG., Conroy MJ., Gill K., Ridley H., Visudtiphole V., Bullough PA., Lakey JH. DIP original experiment: DIP-68163X Structure (London, England : 1993) 2008 IMEx Colicin N binds to the periphery of its receptor and translocator, outer membrane protein F. Baboolal TG., Conroy MJ., Gill K., Ridley H., Visudtiphole V., Bullough PA., Lakey JH. Only protein-protein interactions imex curation baboolal-2008-2 in vitro In vitro comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Baboolal TG., Conroy MJ., Gill K., Ridley H., Visudtiphole V., Bullough PA., Lakey JH. DIP original experiment: DIP-68160X Structure (London, England : 1993) 2008 IMEx Colicin N binds to the periphery of its receptor and translocator, outer membrane protein F. Baboolal TG., Conroy MJ., Gill K., Ridley H., Visudtiphole V., Bullough PA., Lakey JH. Only protein-protein interactions imex curation baboolal-2008-3 in vitro In vitro comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Baboolal TG., Conroy MJ., Gill K., Ridley H., Visudtiphole V., Bullough PA., Lakey JH. DIP original experiment: DIP-68161X Structure (London, England : 1993) 2008 IMEx Colicin N binds to the periphery of its receptor and translocator, outer membrane protein F. Baboolal TG., Conroy MJ., Gill K., Ridley H., Visudtiphole V., Bullough PA., Lakey JH. Only protein-protein interactions imex curation baboolal-2008-4 in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Baboolal TG., Conroy MJ., Gill K., Ridley H., Visudtiphole V., Bullough PA., Lakey JH. DIP original experiment: DIP-68162X Structure (London, England : 1993) 2008 IMEx Colicin N binds to the periphery of its receptor and translocator, outer membrane protein F. Baboolal TG., Conroy MJ., Gill K., Ridley H., Visudtiphole V., Bullough PA., Lakey JH. Only protein-protein interactions imex curation cean_ecolx Colicin-N cna protein protein ecolx Escherichia coli MGSNGADNAHNNAFGGGKNPGIGNTSGAGSNGSASSNRGNSNGWSWSNKPHKNDGFHSDGSYHITFHGDNNSKPKPGGNSGNRGNNGDGASAKVGEITITPDNSKPGRYISSNPEYSLLAKLIDAESIKGTEVYTFHTRKGQYVKVTVPDSNIDKMRVDYVNWKGPKYNNKLVKRFVSQFLLFRKEEKEKNEKEALLKASELVSGMGDKLGEYLGVKYKNVAKEVANDIKNFHGRNIRSYNEAMASLNKVLANPKMKVNKSDKDAIVNAWKQVNAKDMANKIGNLGKAFKVADLAIKVEKIREKSIEGYNTGNWGPLLLEVESWIIGGVVAGVAISLFGAVLSFLPISGLAVTALGVIGIMTISYLSSFIDANRVSNINNIISSVIR ompf_ecoli Outer membrane porin F ompF cmlB tolF coa cry Porin OmpF Outer membrane protein 1A Outer membrane protein IA Outer membrane protein B b0929 JW0912 Outer membrane protein F protein protein ecoli Escherichia coli (strain K12) MMKRNILAVIVPALLVAGTANAAEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF 3F0974D96DB65464 ompf-cna-1 3169281 N/A 3169285 unspecified role unspecified role prey prey Region 1-81 Region 1-81 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3169286 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction false false false ompf-1 3169282 N/A 3169286 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false cna-ompf-1 3169283 N/A 3169285 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3169286 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false cna-ompf-2 3169284 N/A 3169285 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3169286 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false