DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lee-2008-6 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lee IH., Cao L., Mostoslavsky R., Lombard DB., Liu J., Bruns NE., Tsokos M., Alt FW., Finkel T. DIP original experiment: DIP-68364X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A role for the NAD-dependent deacetylase Sirt1 in the regulation of autophagy. Lee IH., Cao L., Mostoslavsky R., Lombard DB., Liu J., Bruns NE., Tsokos M., Alt FW., Finkel T. Only protein-protein interactions imex curation lee-2008-7 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Lee IH., Cao L., Mostoslavsky R., Lombard DB., Liu J., Bruns NE., Tsokos M., Alt FW., Finkel T. DIP original experiment: DIP-68367X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A role for the NAD-dependent deacetylase Sirt1 in the regulation of autophagy. Lee IH., Cao L., Mostoslavsky R., Lombard DB., Liu J., Bruns NE., Tsokos M., Alt FW., Finkel T. Only protein-protein interactions imex curation lee-2008-8 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lee IH., Cao L., Mostoslavsky R., Lombard DB., Liu J., Bruns NE., Tsokos M., Alt FW., Finkel T. DIP original experiment: DIP-68365X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A role for the NAD-dependent deacetylase Sirt1 in the regulation of autophagy. Lee IH., Cao L., Mostoslavsky R., Lombard DB., Liu J., Bruns NE., Tsokos M., Alt FW., Finkel T. Only protein-protein interactions imex curation lee-2008-9 in vitro In vitro deacetylase assay deacetylase assay western blot western blot Immuno blot Immuno blot Lee IH., Cao L., Mostoslavsky R., Lombard DB., Liu J., Bruns NE., Tsokos M., Alt FW., Finkel T. DIP original experiment: DIP-68369X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A role for the NAD-dependent deacetylase Sirt1 in the regulation of autophagy. Lee IH., Cao L., Mostoslavsky R., Lombard DB., Liu J., Bruns NE., Tsokos M., Alt FW., Finkel T. Only protein-protein interactions imex curation lee-2008-10 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Lee IH., Cao L., Mostoslavsky R., Lombard DB., Liu J., Bruns NE., Tsokos M., Alt FW., Finkel T. DIP original experiment: DIP-68368X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A role for the NAD-dependent deacetylase Sirt1 in the regulation of autophagy. Lee IH., Cao L., Mostoslavsky R., Lombard DB., Liu J., Bruns NE., Tsokos M., Alt FW., Finkel T. Only protein-protein interactions imex curation lee-2008-11 in vitro In vitro deacetylase assay deacetylase assay western blot western blot Immuno blot Immuno blot Lee IH., Cao L., Mostoslavsky R., Lombard DB., Liu J., Bruns NE., Tsokos M., Alt FW., Finkel T. DIP original experiment: DIP-68366X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A role for the NAD-dependent deacetylase Sirt1 in the regulation of autophagy. Lee IH., Cao L., Mostoslavsky R., Lombard DB., Liu J., Bruns NE., Tsokos M., Alt FW., Finkel T. Only protein-protein interactions imex curation sir1_human NAD-dependent protein deacetylase sirtuin-1 NAD-dependent protein deacylase sirtuin-1 SIRT1 SIR2L1 SIR2-like protein 1 Regulatory protein SIR2 homolog 1 protein protein human Homo sapiens Human MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREVPAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNLYDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS atg7_human Ubiquitin-like modifier-activating enzyme ATG7 ATG12-activating enzyme E1 ATG7 Ubiquitin-activating enzyme E1-like protein ATG7 APG7L Autophagy-related protein 7 protein protein human Homo sapiens Human MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTADKKLLLEQAANEIWESIKSGTALENPVLLNKFLLLTFADLKKYHFYYWFCYPALCLPESLPLIQGPVGLDQRFSLKQIEALECAYDNLCQTEGVTALPYFLIKYDENMVLVSLLKHYSDFFQGQRTKITIGVYDPCNLAQYPGWPLRNFLVLAAHRWSSSFQSVEVVCFRDRTMQGARDVAHSIIFEVKLPEMAFSPDCPKAVGWEKNQKGGMGPRMVNLSECMDPKRLAESSVDLNLKLMCWRLVPTLDLDKVVSVKCLLLGAGTLGCNVARTLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAADRLQKIFPGVNARGFNMSIPMPGHPVNFSSVTLEQARRDVEQLEQLIESHDVVFLLMDTRESRWLPAVIAASKRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPNHPVASADLLGSSLFANIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEGGYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSSKVLDQYEREGFNFLAKVFNSSHSFLEDLTGLTLLHQETQAAEIWDMSDDETI atg5_human Autophagy protein 5 APG5-like Apoptosis-specific protein ATG5 APG5L ASP protein protein human Homo sapiens Human MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVMRQEDISEIWFEYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDAIEAHFMSCMKEADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD mlp3b_human Microtubule-associated proteins 1A/1B light chain 3B MAP1LC3B MAP1ALC3 Microtubule-associated protein 1 light chain 3 beta MAP1A/MAP1B light chain 3 B MAP1 light chain 3-like protein 2 Autophagy-related protein LC3 B Autophagy-related ubiquitin-like modifier LC3 B protein protein human Homo sapiens Human MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV atg7-sirt1-1 3168399 N/A 3168405 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3168406 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false atg7-sirt1-2 3168400 N/A 3168406 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3168405 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false atg5-sirt1-1 3168401 N/A 3168405 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3168407 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false map1lc3b-sirt1-1 3168402 N/A 3168408 enzyme target enzyme target substrate substrate unspecified role unspecified role human Homo sapiens Human N/A 3168405 enzyme enzyme unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false map1lc3b-sirt1-2 3168403 N/A 3168408 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3168405 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false atg7-sirt1-3 3168404 N/A 3168406 enzyme target enzyme target substrate substrate unspecified role unspecified role human Homo sapiens Human N/A 3168405 enzyme enzyme unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false