DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ nuara-2008-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Nuara AA., Walter LJ., Logsdon NJ., Yoon SI., Jones BC., Schriewer JM., Buller RM., Walter MR. DIP original experiment: DIP-68280X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Structure and mechanism of IFN-gamma antagonism by an orthopoxvirus IFN-gamma-binding protein. Nuara AA., Walter LJ., Logsdon NJ., Yoon SI., Jones BC., Schriewer JM., Buller RM., Walter MR. Only protein-protein interactions imex curation nuara-2008-2 drome Drosophila melanogaster (Fruit fly) Fruit fly x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Nuara AA., Walter LJ., Logsdon NJ., Yoon SI., Jones BC., Schriewer JM., Buller RM., Walter MR. DIP original experiment: DIP-68283X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Structure and mechanism of IFN-gamma antagonism by an orthopoxvirus IFN-gamma-binding protein. Nuara AA., Walter LJ., Logsdon NJ., Yoon SI., Jones BC., Schriewer JM., Buller RM., Walter MR. Only protein-protein interactions imex curation nuara-2008-3 chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Nuara AA., Walter LJ., Logsdon NJ., Yoon SI., Jones BC., Schriewer JM., Buller RM., Walter MR. DIP original experiment: DIP-68281X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Structure and mechanism of IFN-gamma antagonism by an orthopoxvirus IFN-gamma-binding protein. Nuara AA., Walter LJ., Logsdon NJ., Yoon SI., Jones BC., Schriewer JM., Buller RM., Walter MR. Only protein-protein interactions imex curation nuara-2008-4 drome Drosophila melanogaster (Fruit fly) Fruit fly molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Nuara AA., Walter LJ., Logsdon NJ., Yoon SI., Jones BC., Schriewer JM., Buller RM., Walter MR. DIP original experiment: DIP-68284X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Structure and mechanism of IFN-gamma antagonism by an orthopoxvirus IFN-gamma-binding protein. Nuara AA., Walter LJ., Logsdon NJ., Yoon SI., Jones BC., Schriewer JM., Buller RM., Walter MR. Only protein-protein interactions imex curation nuara-2008-5 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Nuara AA., Walter LJ., Logsdon NJ., Yoon SI., Jones BC., Schriewer JM., Buller RM., Walter MR. DIP original experiment: DIP-68282X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Structure and mechanism of IFN-gamma antagonism by an orthopoxvirus IFN-gamma-binding protein. Nuara AA., Walter LJ., Logsdon NJ., Yoon SI., Jones BC., Schriewer JM., Buller RM., Walter MR. Only protein-protein interactions imex curation q66793_9poxv C4R IFNGR EVH185 protein protein ectromelia virus Ectromelia virus MRAIILTVLFINSINATITSYKFESVNFDSKIEWTGNGLYNISLRNYGIKTWQTMYTNVPEGTYDISGFPNNDFVSFWVKFEQGDYKVDKYCTGLCIEVKIGPPTVTLTEYDDHINLYIEHPYATRGSKKIPIYKRNDMCDIYLLYTANFTFGDSEEPVIYDIDDYDCTSTGCSIDFATTEKVCVMAQGATEGLLDKITPWSSEVCLTPKKNVYTCAIRSKEDVPNFKEKMTRVIKRKFNKQSHSYLTKFLGSTSNDITTFLSMLD ifng_human Interferon gamma IFNG Immune interferon protein protein human Homo sapiens Human MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ c4r-ifng-1 3167278 N/A 3167283 unspecified role unspecified role unspecified role unspecified role Region 17-266 Region 17-266 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey N/A 3167284 unspecified role unspecified role unspecified role unspecified role Region 24-161 Region 24-161 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false c4r-1 3167279 N/A 3167283 unspecified role unspecified role unspecified role unspecified role Region 17-266 Region 17-266 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction false false false c4r-2 3167280 N/A 3167283 unspecified role unspecified role unspecified role unspecified role Region 17-266 Region 17-266 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey direct interaction direct interaction false false false c4r-3 3167281 N/A 3167283 unspecified role unspecified role unspecified role unspecified role Region 17-266 Region 17-266 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction false false false c4r-ifng-2 3167282 N/A 3167283 unspecified role unspecified role unspecified role unspecified role Region 17-266 Region 17-266 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3167284 unspecified role unspecified role unspecified role unspecified role Region 24-161 Region 24-161 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false