DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ eswaran-2008-1 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Eswaran J., Bernad A., Ligos JM., Guinea B., Debreczeni JE., Sobott F., Parker SA., Najmanovich R., Turk BE., Knapp S. DIP original experiment: DIP-68056X Structure (London, England : 1993) 2008 IMEx Structure of the human protein kinase MPSK1 reveals an atypical activation loop architecture. Eswaran J., Bernad A., Ligos JM., Guinea B., Debreczeni JE., Sobott F., Parker SA., Najmanovich R., Turk BE., Knapp S. Only protein-protein interactions imex curation eswaran-2008-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Eswaran J., Bernad A., Ligos JM., Guinea B., Debreczeni JE., Sobott F., Parker SA., Najmanovich R., Turk BE., Knapp S. DIP original experiment: DIP-68054X Structure (London, England : 1993) 2008 IMEx Structure of the human protein kinase MPSK1 reveals an atypical activation loop architecture. Eswaran J., Bernad A., Ligos JM., Guinea B., Debreczeni JE., Sobott F., Parker SA., Najmanovich R., Turk BE., Knapp S. Only protein-protein interactions imex curation eswaran-2008-3 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Eswaran J., Bernad A., Ligos JM., Guinea B., Debreczeni JE., Sobott F., Parker SA., Najmanovich R., Turk BE., Knapp S. DIP original experiment: DIP-68055X Structure (London, England : 1993) 2008 IMEx Structure of the human protein kinase MPSK1 reveals an atypical activation loop architecture. Eswaran J., Bernad A., Ligos JM., Guinea B., Debreczeni JE., Sobott F., Parker SA., Najmanovich R., Turk BE., Knapp S. Only protein-protein interactions imex curation eswaran-2008-4 in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Eswaran J., Bernad A., Ligos JM., Guinea B., Debreczeni JE., Sobott F., Parker SA., Najmanovich R., Turk BE., Knapp S. DIP original experiment: DIP-68057X Structure (London, England : 1993) 2008 IMEx Structure of the human protein kinase MPSK1 reveals an atypical activation loop architecture. Eswaran J., Bernad A., Ligos JM., Guinea B., Debreczeni JE., Sobott F., Parker SA., Najmanovich R., Turk BE., Knapp S. Only protein-protein interactions imex curation drg1_mouse Developmentally-regulated GTP-binding protein 1 Drg1 Drg Nedd3 Nedd-3 Neural precursor cell expressed developmentally down-regulated protein 3 Translation factor GTPase DRG1 protein protein mouse Mus musculus Mouse MSGTLAKIAEIEAEMARTQKNKATAHHLGLLKARLAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKK mint May play a role in cell proliferation, differentiation and death stk16_human Serine/threonine-protein kinase 16 STK16 MPSK1 PKL12 TSF1 Protein kinase PKL12 Myristoylated and palmitoylated serine/threonine-protein kinase TGF-beta-stimulated factor 1 hPSK Tyrosine-protein kinase STK16 protein protein human Homo sapiens Human MGHALCVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIHAKGYAHRDLKPTNILLGDEGQPVLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISYRAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYDMVFQKGDSVALAVQNQLSIPQSPRHSSALRQLLNSMMTVDPHQRPHIPLLLSQLEALQPPAPGQHTTQI stk16-drg1-1 3166300 N/A 3166304 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3166305 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false stk16-drg1-2 3166301 N/A 3166304 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3166305 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false drg1-stk16-3 3166302 N/A 3166304 unspecified role unspecified role bait bait Binding region 1-65 Binding region 1-65 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3166305 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false drg1-stk16-4 3166303 N/A 3166304 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli N/A 3166305 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false