DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wittmann-2008-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wittmann JG., Heinrich D., Gasow K., Frey A., Diederichsen U., Rudolph MG. DIP original experiment: DIP-68048X Structure (London, England : 1993) 2008 IMEx Structures of the human orotidine-5'-monophosphate decarboxylase support a covalent mechanism and provide a framework for drug design. Wittmann JG., Heinrich D., Gasow K., Frey A., Diederichsen U., Rudolph MG. Only protein-protein interactions imex curation wittmann-2008-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Wittmann JG., Heinrich D., Gasow K., Frey A., Diederichsen U., Rudolph MG. DIP original experiment: DIP-68047X Structure (London, England : 1993) 2008 IMEx Structures of the human orotidine-5'-monophosphate decarboxylase support a covalent mechanism and provide a framework for drug design. Wittmann JG., Heinrich D., Gasow K., Frey A., Diederichsen U., Rudolph MG. Only protein-protein interactions imex curation p11172-1 Uridine 5'-monophosphate synthase UMPS OK/SW-cl.21 protein protein human Homo sapiens Human MAVARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV umps-1 3166259 N/A 3166261 unspecified role unspecified role unspecified role unspecified role Region 224-480 Region 224-480 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false umps-2 3166260 N/A 3166261 unspecified role unspecified role unspecified role unspecified role Region 224-480 Region 224-480 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false