DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dews-2007-1 ecolx Escherichia coli comigration in gel comigration in gel electrophoresis comigration in gel weight by comassie molecular weight estimation by coomasie staining weight by comassie Dews IC., Mackenzie KR. DIP original experiment: DIP-68725X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Transmembrane domains of the syndecan family of growth factor coreceptors display a hierarchy of homotypic and heterotypic interactions. Dews IC., Mackenzie KR. Only protein-protein interactions imex curation dews-2007-2 in vitro In vitro comigration in gel comigration in gel electrophoresis comigration in gel predetermined predetermined participant predetermined Dews IC., Mackenzie KR. DIP original experiment: DIP-68717X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx f.3 Dews IC., Mackenzie KR. Only protein-protein interactions imex curation dews-2007-3 ecolx Escherichia coli toxcat tox-r dimerization assay toxcat predetermined predetermined participant predetermined Dews IC., Mackenzie KR. DIP original experiment: DIP-68711X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Transmembrane domains of the syndecan family of growth factor coreceptors display a hierarchy of homotypic and heterotypic interactions. Dews IC., Mackenzie KR. Only protein-protein interactions imex curation dews-2007-4 in vitro In vitro comigration in gel comigration in gel electrophoresis comigration in gel predetermined predetermined participant predetermined Dews IC., Mackenzie KR. DIP original experiment: DIP-68721X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx f.3 Dews IC., Mackenzie KR. Only protein-protein interactions imex curation dews-2007-5 ecolx Escherichia coli comigration in gel comigration in gel electrophoresis comigration in gel weight by comassie molecular weight estimation by coomasie staining weight by comassie Dews IC., Mackenzie KR. DIP original experiment: DIP-68724X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Transmembrane domains of the syndecan family of growth factor coreceptors display a hierarchy of homotypic and heterotypic interactions. Dews IC., Mackenzie KR. Only protein-protein interactions imex curation dews-2007-6 ecolx Escherichia coli toxcat tox-r dimerization assay toxcat predetermined predetermined participant predetermined Dews IC., Mackenzie KR. DIP original experiment: DIP-68712X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Transmembrane domains of the syndecan family of growth factor coreceptors display a hierarchy of homotypic and heterotypic interactions. Dews IC., Mackenzie KR. Only protein-protein interactions imex curation dews-2007-7 ecolx Escherichia coli comigration in gel comigration in gel electrophoresis comigration in gel weight by comassie molecular weight estimation by coomasie staining weight by comassie Dews IC., Mackenzie KR. DIP original experiment: DIP-68727X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Transmembrane domains of the syndecan family of growth factor coreceptors display a hierarchy of homotypic and heterotypic interactions. Dews IC., Mackenzie KR. Only protein-protein interactions imex curation dews-2007-8 ecolx Escherichia coli toxcat tox-r dimerization assay toxcat predetermined predetermined participant predetermined Dews IC., Mackenzie KR. DIP original experiment: DIP-68713X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Transmembrane domains of the syndecan family of growth factor coreceptors display a hierarchy of homotypic and heterotypic interactions. Dews IC., Mackenzie KR. Only protein-protein interactions imex curation dews-2007-9 ecolx Escherichia coli comigration in gel comigration in gel electrophoresis comigration in gel weight by comassie molecular weight estimation by coomasie staining weight by comassie Dews IC., Mackenzie KR. DIP original experiment: DIP-68726X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Transmembrane domains of the syndecan family of growth factor coreceptors display a hierarchy of homotypic and heterotypic interactions. Dews IC., Mackenzie KR. Only protein-protein interactions imex curation dews-2007-10 in vitro In vitro comigration in gel comigration in gel electrophoresis comigration in gel predetermined predetermined participant predetermined Dews IC., Mackenzie KR. DIP original experiment: DIP-68730X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx f.3 Dews IC., Mackenzie KR. Only protein-protein interactions imex curation dews-2007-11 ecolx Escherichia coli toxcat tox-r dimerization assay toxcat predetermined predetermined participant predetermined Dews IC., Mackenzie KR. DIP original experiment: DIP-68714X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Transmembrane domains of the syndecan family of growth factor coreceptors display a hierarchy of homotypic and heterotypic interactions. Dews IC., Mackenzie KR. Only protein-protein interactions imex curation dews-2007-12 in vitro In vitro comigration in gel comigration in gel electrophoresis comigration in gel predetermined predetermined participant predetermined Dews IC., Mackenzie KR. DIP original experiment: DIP-68718X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx f.3 Dews IC., Mackenzie KR. Only protein-protein interactions imex curation dews-2007-13 in vitro In vitro comigration in gel comigration in gel electrophoresis comigration in gel predetermined predetermined participant predetermined Dews IC., Mackenzie KR. DIP original experiment: DIP-68715X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx f.3 Please compare description of experiment (E5 - E13) from the text with fig.3 and Table1 - ''SNSyn2, SNSyn3, and SNSyn4 interact with to give complexes'' - I cannot see interaction of SNSyn4 with syn1pep on Fig.3 Dews IC., Mackenzie KR. Only protein-protein interactions imex curation dews-2007-14 in vitro In vitro comigration in gel comigration in gel electrophoresis comigration in gel predetermined predetermined participant predetermined Dews IC., Mackenzie KR. DIP original experiment: DIP-68722X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx f.3 Dews IC., Mackenzie KR. Only protein-protein interactions imex curation dews-2007-15 in vitro In vitro comigration in gel comigration in gel electrophoresis comigration in gel predetermined predetermined participant predetermined Dews IC., Mackenzie KR. DIP original experiment: DIP-68728X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx f.3 Dews IC., Mackenzie KR. Only protein-protein interactions imex curation dews-2007-16 in vitro In vitro comigration in gel comigration in gel electrophoresis comigration in gel predetermined predetermined participant predetermined Dews IC., Mackenzie KR. DIP original experiment: DIP-68719X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx f.3 Dews IC., Mackenzie KR. Only protein-protein interactions imex curation dews-2007-17 ecolx Escherichia coli comigration in gel comigration in gel electrophoresis comigration in gel predetermined predetermined participant predetermined Dews IC., Mackenzie KR. DIP original experiment: DIP-68716X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx f.3 Dews IC., Mackenzie KR. Only protein-protein interactions imex curation dews-2007-18 in vitro In vitro comigration in gel comigration in gel electrophoresis comigration in gel predetermined predetermined participant predetermined Dews IC., Mackenzie KR. DIP original experiment: DIP-68723X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx f.3 Dews IC., Mackenzie KR. Only protein-protein interactions imex curation dews-2007-19 in vitro In vitro comigration in gel comigration in gel electrophoresis comigration in gel weight by comassie molecular weight estimation by coomasie staining weight by comassie Dews IC., Mackenzie KR. DIP original experiment: DIP-68729X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx f.3 Dews IC., Mackenzie KR. Only protein-protein interactions imex curation dews-2007-20 in vitro In vitro comigration in gel comigration in gel electrophoresis comigration in gel predetermined predetermined participant predetermined Dews IC., Mackenzie KR. DIP original experiment: DIP-68720X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx f.3 Dews IC., Mackenzie KR. Only protein-protein interactions imex curation sdc2_human Syndecan-2 SDC2 HSPG1 Fibroglycan Heparan sulfate proteoglycan core protein protein protein human Homo sapiens Human MRRAWILLTLGLVACVSAESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA sdc1_human Syndecan-1 SDC1 SDC protein protein human Homo sapiens Human MRRAALWLWLCALALSLQPALPQIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQTPSTWKDTQLLTAIPTSPEPTGLEATAASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQEATPRPRETTQLPTTHLASTTTATTAQEPATSHPHRDMQPGHHETSTPAGPSQADLHTPHTEDGGPSATERAAEDGASSQLPAAEGSGEQDFTFETSGENTAVVAVEPDRRNQSPVDQGATGASQGLLDRKEVLGGVIAGGLVGLIFAVCLVGFMLYRMKKKDEGSYSLEEPKQANGGAYQKPTKQEEFYA sdc4_human Syndecan-4 SDC4 Amphiglycan Ryudocan core protein protein protein human Homo sapiens Human MAPARLFALLLFFVGGVAESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTEVLAALIVGGIVGILFAVFLILLLMYRMKKKDEGSYDLGKKPIYKKAPTNEFYA sdc3_human Syndecan-3 SDC3 KIAA0468 protein protein human Homo sapiens Human MKPGPPHRAGAAHGAGAGAGAAAGPGARGLLLPPLLLLLLAGRAAGAQRWRSENFERPVDLEGSGDDDSFPDDELDDLYSGSGSGYFEQESGIETAMRFSPDVALAVSTTPAVLPTTNIQPVGTPFEELPSERPTLEPATSPLVVTEVPEEPSQRATTVSTTMATTAATSTGDPTVATVPATVATATPSTPAAPPFTATTAVIRTTGVRRLLPLPLTTVATARATTPEAPSPPTTAAVLDTEAPTPRLVSTATSRPRALPRPATTQEPDIPERSTLPLGTTAPGPTEVAQTPTPETFLTTIRDEPEVPVSGGPSGDFELPEEETTQPDTANEVVAVGGAAAKASSPPGTLPKGARPGPGLLDNAIDSGSSAAQLPQKSILERKEVLVAVIVGGVVGALFAAFLVTLLIYRMKKKDEGSYTLEEPKQASVTYQKPDKQEEFYA sdc2-1 3165618 N/A 3165638 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false sdc1-sdc2-3 3165619 N/A 3165639 unspecified role unspecified role unspecified role unspecified role 241-287 binding site 241-287 binding site sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165638 unspecified role unspecified role unspecified role unspecified role P34741:p.Gly152Leu G152L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false P34741:p.Gly156Leu G156L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false sdc1-1 3165620 N/A 3165639 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false sdc3-sdc4-2 3165621 N/A 3165640 unspecified role unspecified role unspecified role unspecified role 135-176 binding site 135-176 binding site sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165641 unspecified role unspecified role unspecified role unspecified role G392L G392L sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false O75056:p.Gly396Leu G396L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false sdc1-2 3165622 N/A 3165639 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false sdc2-2 3165623 N/A 3165638 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false sdc4-1 3165624 N/A 3165640 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false sdc3-1 3165625 N/A 3165641 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false sdc3-2 3165626 N/A 3165641 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false sdc4-sdc4-3 3165627 N/A 3165640 unspecified role unspecified role unspecified role unspecified role 135-176 binding site 135-176 binding site sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165640 unspecified role unspecified role unspecified role unspecified role P31431:p.Gly153Leu G153L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false P31431:p.Gly157Leu G157L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false sdc4-2 3165628 N/A 3165640 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false sdc2-sdc3-2 3165629 N/A 3165641 unspecified role unspecified role unspecified role unspecified role 375-418 binding site 375-418 binding site sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165638 unspecified role unspecified role unspecified role unspecified role P34741:p.Gly152Leu G152L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false P34741:p.Gly156Leu G156L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false sdc1-sdc2-4 3165630 N/A 3165638 unspecified role unspecified role unspecified role unspecified role 134-175 binding site 134-175 binding site sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165639 unspecified role unspecified role unspecified role unspecified role P18827:p.Gly259Leu G259L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false P18827:p.Gly263Leu G263L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false sdc2-sdc4-5 3165631 N/A 3165638 unspecified role unspecified role unspecified role unspecified role 134-175 binding site 134-175 binding site sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165640 unspecified role unspecified role unspecified role unspecified role P31431:p.Gly153Leu G153L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false P31431:p.Gly157Leu G157L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false sdc2-sdc2-3 3165632 N/A 3165638 unspecified role unspecified role unspecified role unspecified role 134-175 binding site 134-175 binding site sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165638 unspecified role unspecified role unspecified role unspecified role P34741:p.Gly152Leu G152L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false P34741:p.Gly156Leu G156L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false sdc2-sdc4-6 3165633 N/A 3165640 unspecified role unspecified role unspecified role unspecified role 135-176 binding site 135-176 binding site sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165638 unspecified role unspecified role unspecified role unspecified role P34741:p.Gly152Leu G152L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false P34741:p.Gly156Leu G156L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false sdc1-sdc3-1 3165634 N/A 3165641 unspecified role unspecified role unspecified role unspecified role binding site 375-418 binding site 375-418 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165639 unspecified role unspecified role unspecified role unspecified role P18827:p.Gly259Leu G259L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false P18827:p.Gly263Leu G263L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false sdc3-sdc4-3 3165635 N/A 3165641 unspecified role unspecified role unspecified role unspecified role 375-418 binding site 375-418 binding site sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165640 unspecified role unspecified role unspecified role unspecified role P31431:p.Gly153Leu G153L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false P31431:p.Gly157Leu G157L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false sdc3-sdc3-1 3165636 N/A 3165641 unspecified role unspecified role unspecified role unspecified role binding site 375-418 binding site 375-418 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165641 unspecified role unspecified role unspecified role unspecified role O75056:p.Gly392Leu G392L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false O75056:p.Gly396Leu G396L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false sdc2-sdc3-3 3165637 N/A 3165638 unspecified role unspecified role unspecified role unspecified role binding site 134-175 binding site 134-175 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165641 unspecified role unspecified role unspecified role unspecified role O75056:p.Gly392Leu G392L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false O75056:p.Gly396Leu G396L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false