DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wang-2007-32 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang B., Elledge SJ. DIP original experiment: DIP-68692X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Ubc13/Rnf8 ubiquitin ligases control foci formation of the Rap80/Abraxas/Brca1/Brcc36 complex in response to DNA damage. Wang B., Elledge SJ. Only protein-protein interactions imex curation wang-2007-33 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Wang B., Elledge SJ. DIP original experiment: DIP-68690X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Ubc13/Rnf8 ubiquitin ligases control foci formation of the Rap80/Abraxas/Brca1/Brcc36 complex in response to DNA damage. Wang B., Elledge SJ. Only protein-protein interactions imex curation wang-2007-34 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang B., Elledge SJ. DIP original experiment: DIP-68694X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Ubc13/Rnf8 ubiquitin ligases control foci formation of the Rap80/Abraxas/Brca1/Brcc36 complex in response to DNA damage. Wang B., Elledge SJ. Only protein-protein interactions imex curation wang-2007-35 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang B., Elledge SJ. DIP original experiment: DIP-68695X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Ubc13/Rnf8 ubiquitin ligases control foci formation of the Rap80/Abraxas/Brca1/Brcc36 complex in response to DNA damage. Wang B., Elledge SJ. Only protein-protein interactions imex curation wang-2007-36 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang B., Elledge SJ. DIP original experiment: DIP-68693X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Ubc13/Rnf8 ubiquitin ligases control foci formation of the Rap80/Abraxas/Brca1/Brcc36 complex in response to DNA damage. Wang B., Elledge SJ. Only protein-protein interactions imex curation wang-2007-37 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang B., Elledge SJ. DIP original experiment: DIP-68691X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Ubc13/Rnf8 ubiquitin ligases control foci formation of the Rap80/Abraxas/Brca1/Brcc36 complex in response to DNA damage. Wang B., Elledge SJ. Only protein-protein interactions imex curation wang-2007-38 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Wang B., Elledge SJ. DIP original experiment: DIP-68696X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Ubc13/Rnf8 ubiquitin ligases control foci formation of the Rap80/Abraxas/Brca1/Brcc36 complex in response to DNA damage. Wang B., Elledge SJ. Only protein-protein interactions imex curation q96rl1-1 BRCA1-A complex subunit RAP80 UIMC1 RXRIP110 Receptor-associated protein 80 Retinoid X receptor-interacting protein 110 Ubiquitin interaction motif-containing protein 1 RAP80 protein protein human Homo sapiens Human MPRRKKKVKEVSESRNLEKKDVETTSSVSVKRKRRLEDAFIVISDSDGEEPKEENGLQKTKTKQSNRAKCLAKRKIAQMTEEEQFALALKMSEQEAREVNSQEEEEEELLRKAIAESLNSCRPSDASATRSRPLATGPSSQSHQEKTTDSGLTEGIWQLVPPSLFKGSHISQGNEAEEREEPWDHTEKTEEEPVSGSSGSWDQSSQPVFENVNVKSFDRCTGHSAEHTQCGKPQESTGRGSAFLKAVQGSGDTSRHCLPTLADAKGLQDTGGTVNYFWGIPFCPDGVDPNQYTKVILCQLEVYQKSLKMAQRQLLNKKGFGEPVLPRPPSLIQNECGQGEQASEKNECISEDMGDEDKEERQESRASDWHSKTKDFQESSIKSLKEKLLLEEEPTTSHGQSSQGIVEETSEEGNSVPASQSVAALTSKRSLVLMPESSAEEITVCPETQLSSSETFDLEREVSPGSRDILDGVRIIMADKEVGNKEDAEKEVAISTFSSSNQVSCPLCDQCFPPTKIERHAMYCNGLMEEDTVLTRRQKEAKTKSDSGTAAQTSLDIDKNEKCYLCKSLVPFREYQCHVDSCLQLAKADQGDGPEGSGRACSTVEGKWQQRLKNPKEKGHSEGRLLSFLEQSEHKTSDADIKSSETGAFRVPSPGMEEAGCSREMQSSFTRRDLNESPVKSFVSISEATDCLVDFKKQVTVQPGSRTRTKAGRGRRRKF brcc3_human Lys-63-specific deubiquitinase BRCC36 BRCC3 C6.1A CXorf53 BRCC36 BRCA1-A complex subunit BRCC36 BRISC complex subunit BRCC36 BRCA1/BRCA2-containing complex subunit 3 BRCA1/BRCA2-containing complex subunit 36 protein protein human Homo sapiens Human MAVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMQELSSLE This sequence has been withdrawn from Uniprot. 5720358C1A2F7421 abrx1_human BRCA1-A complex subunit Abraxas 1 ABRAXAS1 ABRA1 CCDC98 Coiled-coil domain-containing protein 98 FAM175A Protein FAM175A UNQ496/PRO1013 protein protein human Homo sapiens Human MEGESTSAVLSGFVLGALAFQHLNTDSDTEGFLLGEVKGEAKNSITDSQMDDVEVVYTIDIQKYIPCYQLFSFYNSSGEVNEQALKKILSNVKKNVVGWYKFRRHSDQIMTFRERLLHKNLQEHFSNQDLVFLLLTPSIITESCSTHRLEHSLYKPQKGLFHRVPLVVANLGMSEQLGYKTVSGSCMSTGFSRAVQTHSSKFFEEDGSLKEVHKINEMYASLQEELKSICKKVEDSEQAVDKLVKDVNRLKREIEKRRGAQIQAAREKNIQKDPQENIFLCQALRTFFPNSEFLHSCVMSLKNRHVSKSSCNYNHHLDVVDNLTLMVEHTDIPEASPASTPQIIKHKALDLDDRWQFKRSRLLDTQDKRSKADTGSSNQDKASKMSSPETDEEIEKMKGFGEYSRSPTF This sequence has been withdrawn from Uniprot. uimc1-brcc36-1 3293828 N/A 3293835 unspecified role unspecified role bait bait Binding region 300-400 Binding region 300-400 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3293836 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false abraxas-uimc1-1 3293829 N/A 3293835 unspecified role unspecified role prey prey Binding region 300-400 Binding region 300-400 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3293837 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false uimc1-brcc36-2 3293830 N/A 3293835 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3293836 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false abraxas-brcc36-1 3293831 N/A 3293836 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3293837 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false abraxas-brcc36-2 3293832 N/A 3293836 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3293837 unspecified role unspecified role bait bait Binding region 200-270 Binding region 200-270 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false abraxas-uimc1-2 3293833 N/A 3293835 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3293837 unspecified role unspecified role bait bait Binding region 1-360 Binding region 1-360 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false abraxas-brcc36-3 3293834 N/A 3293836 unspecified role unspecified role prey prey Binding region 250-316 Binding region 250-316 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3293837 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false