DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ sebag-2007-1 crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sebag JA., Hinkle PM. DIP original experiment: DIP-68741X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Melanocortin-2 receptor accessory protein MRAP forms antiparallel homodimers. Sebag JA., Hinkle PM. Only protein-protein interactions imex curation sebag-2007-2 crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sebag JA., Hinkle PM. DIP original experiment: DIP-68739X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Melanocortin-2 receptor accessory protein MRAP forms antiparallel homodimers. Sebag JA., Hinkle PM. Only protein-protein interactions imex curation sebag-2007-3 crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Sebag JA., Hinkle PM. DIP original experiment: DIP-68740X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Melanocortin-2 receptor accessory protein MRAP forms antiparallel homodimers. Sebag JA., Hinkle PM. Only protein-protein interactions imex curation acthr_human Adrenocorticotropic hormone receptor MC2R ACTHR Adrenocorticotropin receptor Melanocortin receptor 2 protein protein human Homo sapiens Human MKHIINSYENINNTARNNSDCPRVVLPEEIFFTISIVGVLENLIVLLAVFKNKNLQAPMYFFICSLAISDMLGSLYKILENILIILRNMGYLKPRGSFETTADDIIDSLFVLSLLGSIFSLSVIAADRYITIFHALRYHSIVTMRRTVVVLTVIWTFCTGTGITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFLLARSHTRKISTLPRANMKGAITLTILLGVFIFCWAPFVLHVLLMTFCPSNPYCACYMSLFQVNGMLIMCNAVIDPFIYAFRSPELRDAFKKMIFCSRYW mrap_human Melanocortin-2 receptor accessory protein MRAP B27 C21orf61 FALP Fat cell-specific low molecular weight protein Fat tissue-specific low MW protein protein protein human Homo sapiens Human MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYMSWSASPQMRNSPKHHQTCPWSHGLNLHLCIQKCLPCHREPLATSQAQASSVEPGSRTGPDQPLRQESSSTLPLGGFQTHPTLLWELTLNGGPLVRSKPSEPPPGDRTSQLQS mrap-mc2r-1 3165417 N/A 3165420 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster N/A 3165421 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster physical association physical association false false false mrap-mc2r-2 3165418 N/A 3165420 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster N/A 3165421 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster physical association physical association false false false mrap-mrap-2 3165419 N/A 3165421 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster N/A 3165421 unspecified role unspecified role prey prey V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster physical association physical association false false false