DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ chamieh-2008-1 in vitro In vitro atpase assay atpase assay predetermined predetermined participant predetermined Chamieh H., Ballut L., Bonneau F., Le Hir H. DIP original experiment: DIP-255349X Nature structural & molecular biology 2008 IMEx NMD factors UPF2 and UPF3 bridge UPF1 to the exon junction complex and stimulate its RNA helicase activity. Chamieh H., Ballut L., Bonneau F., Le Hir H. Only protein-protein interactions imex curation chamieh-2008-2 in vitro In vitro tap tandem affinity purification TAP TAP tap weight by comassie molecular weight estimation by coomasie staining weight by comassie Chamieh H., Ballut L., Bonneau F., Le Hir H. DIP original experiment: DIP-255343X Nature structural & molecular biology 2008 IMEx NMD factors UPF2 and UPF3 bridge UPF1 to the exon junction complex and stimulate its RNA helicase activity. Chamieh H., Ballut L., Bonneau F., Le Hir H. Only protein-protein interactions imex curation chamieh-2008-3 ecolx Escherichia coli tap tandem affinity purification TAP TAP tap weight by comassie molecular weight estimation by coomasie staining weight by comassie Chamieh H., Ballut L., Bonneau F., Le Hir H. DIP original experiment: DIP-255332X Nature structural & molecular biology 2008 IMEx NMD factors UPF2 and UPF3 bridge UPF1 to the exon junction complex and stimulate its RNA helicase activity. Chamieh H., Ballut L., Bonneau F., Le Hir H. Only protein-protein interactions imex curation chamieh-2008-4 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Chamieh H., Ballut L., Bonneau F., Le Hir H. DIP original experiment: DIP-255339X Nature structural & molecular biology 2008 IMEx NMD factors UPF2 and UPF3 bridge UPF1 to the exon junction complex and stimulate its RNA helicase activity. Chamieh H., Ballut L., Bonneau F., Le Hir H. Only protein-protein interactions imex curation chamieh-2008-5 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Chamieh H., Ballut L., Bonneau F., Le Hir H. DIP original experiment: DIP-255336X Nature structural & molecular biology 2008 IMEx NMD factors UPF2 and UPF3 bridge UPF1 to the exon junction complex and stimulate its RNA helicase activity. Chamieh H., Ballut L., Bonneau F., Le Hir H. Only protein-protein interactions imex curation chamieh-2008-6 in vitro In vitro tap tandem affinity purification TAP TAP tap weight by comassie molecular weight estimation by coomasie staining weight by comassie Chamieh H., Ballut L., Bonneau F., Le Hir H. DIP original experiment: DIP-255346X Nature structural & molecular biology 2008 IMEx NMD factors UPF2 and UPF3 bridge UPF1 to the exon junction complex and stimulate its RNA helicase activity. Chamieh H., Ballut L., Bonneau F., Le Hir H. Only protein-protein interactions imex curation chamieh-2008-7 in vitro In vitro tap tandem affinity purification TAP TAP tap weight by comassie molecular weight estimation by coomasie staining weight by comassie Chamieh H., Ballut L., Bonneau F., Le Hir H. DIP original experiment: DIP-255333X Nature structural & molecular biology 2008 IMEx NMD factors UPF2 and UPF3 bridge UPF1 to the exon junction complex and stimulate its RNA helicase activity. Chamieh H., Ballut L., Bonneau F., Le Hir H. Only protein-protein interactions imex curation chamieh-2008-8 in vitro In vitro tap tandem affinity purification TAP TAP tap weight by comassie molecular weight estimation by coomasie staining weight by comassie Chamieh H., Ballut L., Bonneau F., Le Hir H. DIP original experiment: DIP-255341X Nature structural & molecular biology 2008 IMEx NMD factors UPF2 and UPF3 bridge UPF1 to the exon junction complex and stimulate its RNA helicase activity. Chamieh H., Ballut L., Bonneau F., Le Hir H. Only protein-protein interactions imex curation chamieh-2008-9 in vitro In vitro tap tandem affinity purification TAP TAP tap weight by comassie molecular weight estimation by coomasie staining weight by comassie Chamieh H., Ballut L., Bonneau F., Le Hir H. DIP original experiment: DIP-255345X Nature structural & molecular biology 2008 IMEx NMD factors UPF2 and UPF3 bridge UPF1 to the exon junction complex and stimulate its RNA helicase activity. Chamieh H., Ballut L., Bonneau F., Le Hir H. Only protein-protein interactions imex curation chamieh-2008-10 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Chamieh H., Ballut L., Bonneau F., Le Hir H. DIP original experiment: DIP-255334X Nature structural & molecular biology 2008 IMEx NMD factors UPF2 and UPF3 bridge UPF1 to the exon junction complex and stimulate its RNA helicase activity. Chamieh H., Ballut L., Bonneau F., Le Hir H. Only protein-protein interactions imex curation chamieh-2008-11 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Chamieh H., Ballut L., Bonneau F., Le Hir H. DIP original experiment: DIP-255337X Nature structural & molecular biology 2008 IMEx NMD factors UPF2 and UPF3 bridge UPF1 to the exon junction complex and stimulate its RNA helicase activity. Chamieh H., Ballut L., Bonneau F., Le Hir H. Only protein-protein interactions imex curation chamieh-2008-12 in vitro In vitro tap tandem affinity purification TAP TAP tap weight by comassie molecular weight estimation by coomasie staining weight by comassie Chamieh H., Ballut L., Bonneau F., Le Hir H. DIP original experiment: DIP-255348X Nature structural & molecular biology 2008 IMEx NMD factors UPF2 and UPF3 bridge UPF1 to the exon junction complex and stimulate its RNA helicase activity. Chamieh H., Ballut L., Bonneau F., Le Hir H. Only protein-protein interactions imex curation chamieh-2008-13 in vitro In vitro tap tandem affinity purification TAP TAP tap weight by comassie molecular weight estimation by coomasie staining weight by comassie Chamieh H., Ballut L., Bonneau F., Le Hir H. DIP original experiment: DIP-255340X Nature structural & molecular biology 2008 IMEx NMD factors UPF2 and UPF3 bridge UPF1 to the exon junction complex and stimulate its RNA helicase activity. Chamieh H., Ballut L., Bonneau F., Le Hir H. Only protein-protein interactions imex curation chamieh-2008-14 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Chamieh H., Ballut L., Bonneau F., Le Hir H. DIP original experiment: DIP-255335X Nature structural & molecular biology 2008 IMEx NMD factors UPF2 and UPF3 bridge UPF1 to the exon junction complex and stimulate its RNA helicase activity. Chamieh H., Ballut L., Bonneau F., Le Hir H. Only protein-protein interactions imex curation chamieh-2008-15 in vitro In vitro tap tandem affinity purification TAP TAP tap weight by comassie molecular weight estimation by coomasie staining weight by comassie Chamieh H., Ballut L., Bonneau F., Le Hir H. DIP original experiment: DIP-255342X Nature structural & molecular biology 2008 IMEx NMD factors UPF2 and UPF3 bridge UPF1 to the exon junction complex and stimulate its RNA helicase activity. Chamieh H., Ballut L., Bonneau F., Le Hir H. Only protein-protein interactions imex curation chamieh-2008-16 in vitro In vitro tap tandem affinity purification TAP TAP tap weight by comassie molecular weight estimation by coomasie staining weight by comassie Chamieh H., Ballut L., Bonneau F., Le Hir H. DIP original experiment: DIP-255347X Nature structural & molecular biology 2008 IMEx NMD factors UPF2 and UPF3 bridge UPF1 to the exon junction complex and stimulate its RNA helicase activity. Chamieh H., Ballut L., Bonneau F., Le Hir H. Only protein-protein interactions imex curation chamieh-2008-17 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Chamieh H., Ballut L., Bonneau F., Le Hir H. DIP original experiment: DIP-255338X Nature structural & molecular biology 2008 IMEx NMD factors UPF2 and UPF3 bridge UPF1 to the exon junction complex and stimulate its RNA helicase activity. Chamieh H., Ballut L., Bonneau F., Le Hir H. Only protein-protein interactions imex curation chamieh-2008-18 in vitro In vitro tap tandem affinity purification TAP TAP tap weight by comassie molecular weight estimation by coomasie staining weight by comassie Chamieh H., Ballut L., Bonneau F., Le Hir H. DIP original experiment: DIP-255344X Nature structural & molecular biology 2008 IMEx NMD factors UPF2 and UPF3 bridge UPF1 to the exon junction complex and stimulate its RNA helicase activity. Chamieh H., Ballut L., Bonneau F., Le Hir H. Only protein-protein interactions imex curation chamieh-2008-19 in vitro In vitro atpase assay atpase assay predetermined predetermined participant predetermined Chamieh H., Ballut L., Bonneau F., Le Hir H. DIP original experiment: DIP-255350X Nature structural & molecular biology 2008 IMEx NMD factors UPF2 and UPF3 bridge UPF1 to the exon junction complex and stimulate its RNA helicase activity. Chamieh H., Ballut L., Bonneau F., Le Hir H. Only protein-protein interactions imex curation casc3_human Protein CASC3 CASC3 MLN51 Cancer susceptibility candidate gene 3 protein Metastatic lymph node gene 51 protein Protein barentsz protein protein human Homo sapiens Human MADRRRQRASQDTEDEESGASGSDSGGSPLRGGGSCSGSAGGGGSGSLPSQRGGRTGALHLRRVESGGAKSAEESECESEDGIEGDAVLSDYESAEDSEGEEGEYSEEENSKVELKSEANDAVNSSTKEEKGEEKPDTKSTVTGERQSGDGQESTEPVENKVGKKGPKHLDDDEDRKNPAYIPRKGLFFEHDLRGQTQEEEVRPKGRQRKLWKDEGRWEHDKFREDEQAPKSRQELIALYGYDIRSAHNPDDIKPRRIRKPRYGSPPQRDPNWNGERLNKSHRHQGLGGTLPPRTFINRNAAGTGRMSAPRNYSRSGGFKEGRAGFRPVEAGGQHGGRSGETVKHEISYRSRRLEQTSVRDPSPEADAPVLGSPEKEEAASEPPAAAPDAAPPPPDRPIEKKSYSRARRTRTKVGDAVKLAEEVPPPPEGLIPAPPVPETTPTPPTKTGTWEAPVDSSTSGLEQDVAQLNIAEQNWSPGQPSFLQPRELRGMPNHIHMGAGPPPQFNRMEEMGVQGGRAKRYSSQRQRPVPEPPAPPVHISIMEGHYYDPLQFQGPIYTHGDSPAPLPPQGMLVQPGMNLPHPGLHPHQTPAPLPNPGLYPPPVSMSPGQPPPQQLLAPTYFSAPGVMNFGNPSYPYAPGALPPPPPPHLYPNTQAPSQVYGGVTYYNPAQQQVQPKPSPPRRTPQPVTIKPPPPEVVSRGSS if4a3_human Eukaryotic initiation factor 4A-III KIAA0111 EIF4A3 DDX48 Eukaryotic translation initiation factor 4A isoform 3 ATP-dependent RNA helicase eIF4A-3 ATP-dependent RNA helicase DDX48 DEAD box protein 48 Eukaryotic initiation factor 4A-like NUK-34 Nuclear matrix protein 265 protein protein human Homo sapiens Human MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI q9y5s9-1 RNA-binding protein 8A RBM8A Binder of OVCA1-1 RBM8 RNA-binding motif protein 8A RNA-binding protein Y14 Ribonucleoprotein RBM8A HSPC114 MDS014 BOV-1a protein protein human Homo sapiens Human MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR mgn_human Protein mago nashi homolog MAGOH MAGOHA protein protein human Homo sapiens Human MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI q9bzi7-2 Regulator of nonsense transcripts 3B UPF3B RENT3B UPF3X Nonsense mRNA reducing factor 3B Up-frameshift suppressor 3 homolog B Up-frameshift suppressor 3 homolog on chromosome X protein protein human Homo sapiens Human MKEEKEHRPKEKRVTLLTPAGATGSGGGTSGDSSKGEDKQDRNKEKKEALSKVVIRRLPPTLTKEQLQEHLQPMPEHDYFEFFSNDTSLYPHMYARAYINFKNQEDIILFRDRFDGYVFLDNKGQEYPAIVEFAPFQKAAKKKTKKRDTKVGTIDDDPEYRKFLESYATDNEKMTSTPETLLEEIEAKNRELIAKKTTPLLSFLKNKQRMREEKREERRRREIERKRQREEERRKWKEEEKRKRKDIEKLKKIDRIPERDKLKDEPKIKLLKKPEKGDEKELDKREKAKKLDKENLSDERASGQSCTLPKRSDSELKDEKPKRPEDESGRDYREREREYERDQERILRERERLKRQEEERRRQKERYEKEKTFKRKEEEMKKEKDTLRDKGKKAESTESIGSSEKTEKKEEVVKRDRIRNKDRPAMQLYQPGARSRNRLCPPDDSTKSGDSAAERKQESGISHRKEGGEE q92900-2 Regulator of nonsense transcripts 1 UPF1 KIAA0221 RENT1 ATP-dependent helicase RENT1 Nonsense mRNA reducing factor 1 Up-frameshift suppressor 1 homolog protein protein human Homo sapiens Human MSVEAYGPSSQTLTFLDTEEAELLGADTQGSEFEFTDFTLPSQTQTPPGGPGGPGGGGAGGPGGAGAGAAAGQLDAQVGPEGILQNGAVDDSVAKTSQLLAELNFEEDEEDTYYTKDLPIHACSYCGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHLVRAKCKEVTLHKDGPLGETVLECYNCGCRNVFLLGFIPAKADSVVVLLCRQPCASQSSLKDINWDSSQWQPLIQDRCFLSWLVKIPSEQEQLRARQITAQQINKLEELWKENPSATLEDLEKPGVDEEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTDSDMRLMQGDEICLRYKGDLAPLWKGIGHVIKVPDNYGDEIAIELRSSVGAPVEVTHNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNGPVLVCAPSNIAVDQLTEKIHQTGLKVVRLCAKSREAIDSPVSFLALHNQIRNMDSMPELQKLQQLKDETGELSSADEKRYRALKRTAERELLMNADVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLGAKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIRLQVQYRMHPALSAFPSNIFYEGSLQNGVTAADRVKKGFDFQWPQPDKPMFFYVTQGQEEIASSGTSYLNRTEAANVEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLVEGPLNNLRESLMQFSKPRKLVNTINPGARFMTTAMYDAREAIIPGSVYDRSSQGRPSSMYFQTHDQIGMISAGPSHVAAMNIPIPFNLVMPPMPPPGYFGQANGPAAGRGTPKGKTGRGGRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQGYISMSQPSQMSQPGLSQPELSQDSYLGDEFKSQIDVALSQDSTYQGERAYQHGGVTGLSQY No experimental confirmation available rent2_human Regulator of nonsense transcripts 2 Nonsense mRNA reducing factor 2 Up-frameshift suppressor 2 homolog UPF2 KIAA1408 RENT2 protein protein human Homo sapiens Human MPAERKKPASMEEKDSLPNNKEKDCSERRTVSSKERPKDDIKLTAKKEVSKAPEDKKKRLEDDKRKKEDKERKKKDEEKVKAEEESKKKEEEEKKKHQEEERKKQEEQAKRQQEEEAAAQMKEKEESIQLHQEAWERHHLRKELRSKNQNAPDSRPEENFFSRLDSSLKKNTAFVKKLKTITEQQRDSLSHDFNGLNLSKYIAEAVASIVEAKLKISDVNCAVHLCSLFHQRYADFAPSLLQVWKKHFEARKEEKTPNITKLRTDLRFIAELTIVGIFTDKEGLSLIYEQLKNIINADRESHTHVSVVISFCRHCGDDIAGLVPRKVKSAAEKFNLSFPPSEIISPEKQQPFQNLLKEYFTSLTKHLKRDHRELQNTERQNRRILHSKGELSEDRHKQYEEFAMSYQKLLANSQSLADLLDENMPDLPQDKPTPEEHGPGIDIFTPGKPGEYDLEGGIWEDEDARNFYENLIDLKAFVPAILFKDNEKSCQNKESNKDDTKEAKESKENKEVSSPDDLELELENLEINDDTLELEGGDEAEDLTKKLLDEQEQEDEEASTGSHLKLIVDAFLQQLPNCVNRDLIDKAAMDFCMNMNTKANRKKLVRALFIVPRQRLDLLPFYARLVATLHPCMSDVAEDLCSMLRGDFRFHVRKKDQINIETKNKTVRFIGELTKFKMFTKNDTLHCLKMLLSDFSHHHIEMACTLLETCGRFLFRSPESHLRTSVLLEQMMRKKQAMHLDARYVTMVENAYYYCNPPPAEKTVKKKRPPLQEYVRKLLYKDLSKVTTEKVLRQMRKLPWQDQEVKDYVICCMINIWNVKYNSIHCVANLLAGLVLYQEDVGIHVVDGVLEDIRLGMEVNQPKFNQRRISSAKFLGELYNYRMVESAVIFRTLYSFTSFGVNPDGSPSSLDPPEHLFRIRLVCTILDTCGQYFDRGSSKRKLDCFLVYFQRYVWWKKSLEVWTKDHPFPIDIDYMISDTLELLRPKIKLCNSLEESIRQVQDLEREFLIKLGLVNDKDSKDSMTEGENLEEDEEEEEGGAETEEQSGNESEVNEPEEEEGSDNDDDEGEEEEEENTDYLTDSNKENETDEENTEVMIKGGGLKHVPCVEDEDFIQALDKMMLENLQQRSGESVKVHQLDVAIPLHLKSQLRKGPPLGGGEGEAESADTMPFVMLTRKGNKQQFKILNVPMSSQLAANHWNQQQAEQEERMRMKKLTLDINERQEQEDYQEMLQSLAQRPAPANTNRERRPRYQHPKGAPNADLIFKTGGRRR pym1_human Partner of Y14 and mago PYM1 PYM PYM homolog 1 exon junction complex-associated factor Protein wibg homolog WIBG protein protein human Homo sapiens Human MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAPVTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASDQPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGL casc3-eif4a3-3 3165044 N/A 3165063 unspecified role unspecified role unspecified role unspecified role Region 137-283 Region 137-283 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165064 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false magoh-casc3-3 3165045 N/A 3165065 unspecified role unspecified role prey prey Region 50-174 Region 50-174 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165063 unspecified role unspecified role prey prey Region 137-283 Region 137-283 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165064 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3165066 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3165067 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false magoh-rbm8a-20 3165046 N/A 3165065 unspecified role unspecified role prey prey Region 50-174 Region 50-174 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165066 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false upf1-casc3-1 3165047 N/A 3165065 unspecified role unspecified role prey prey Region 50-174 Region 50-174 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165063 unspecified role unspecified role prey prey Region 137-283 Region 137-283 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165064 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3165066 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3165067 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3165068 unspecified role unspecified role bait bait CBP-tag CBP-tag cam tag calmodulin binding protein tag cam tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 115-914 Region 115-914 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165069 unspecified role unspecified role prey prey Region 770-1204 Region 770-1204 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false upf3b-upf2-2 3165048 N/A 3165067 unspecified role unspecified role bait bait Region 1-420 Region 1-420 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 1-92 Region 1-92 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false CBP-tag CBP-tag cam tag calmodulin binding protein tag cam tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli N/A 3165069 unspecified role unspecified role prey prey Region 770-1204 Region 770-1204 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false magoh-pym1-1 3165049 N/A 3165065 unspecified role unspecified role prey prey Region 50-174 Region 50-174 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165070 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3165066 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false casc3-eif4a3-4 3165050 N/A 3165063 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 137-283 Region 137-283 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165064 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false casc3-eif4a3-5 3165051 N/A 3165065 unspecified role unspecified role prey prey Region 50-174 Region 50-174 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165063 unspecified role unspecified role bait bait Region 137-283 Region 137-283 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3165064 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3165066 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3165067 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false magoh-upf3b-1 3165052 N/A 3165066 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P61326:p.[Asp66Ala;Glu68Ala] D66A/E68A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165067 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false upf1-upf2-10 3165053 N/A 3165068 unspecified role unspecified role bait bait CBP-tag CBP-tag cam tag calmodulin binding protein tag cam tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 115-914 Region 115-914 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165069 unspecified role unspecified role prey prey Region 770-1204 Region 770-1204 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false upf1-upf2-11 3165054 N/A 3165068 unspecified role unspecified role bait bait CBP-tag CBP-tag cam tag calmodulin binding protein tag cam tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 115-914 Region 115-914 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165069 unspecified role unspecified role prey prey Region 770-1204 Region 770-1204 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165067 unspecified role unspecified role prey prey Region 1-420 Region 1-420 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false casc3-eif4a3-6 3165055 N/A 3165065 unspecified role unspecified role prey prey Region 50-174 Region 50-174 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165063 unspecified role unspecified role bait bait Region 137-283 Region 137-283 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3165064 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3165066 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false eif4a3-casc3-4 3165056 N/A 3165065 unspecified role unspecified role prey prey Region 50-174 Region 50-174 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165063 unspecified role unspecified role prey prey Region 137-283 Region 137-283 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165064 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3165066 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3165067 unspecified role unspecified role prey prey Region 93-470 Region 93-470 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false upf3b-upf1-1 3165057 N/A 3165068 unspecified role unspecified role prey prey Region 115-914 Region 115-914 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165069 unspecified role unspecified role prey prey Region 770-1204 Region 770-1204 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165067 unspecified role unspecified role bait bait Region 1-420 Region 1-420 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false CBP-tag CBP-tag cam tag calmodulin binding protein tag cam tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Region 1-92 Region 1-92 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false eif4a3-magoh-2 3165058 N/A 3165065 unspecified role unspecified role prey prey Region 50-174 Region 50-174 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165064 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3165066 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3165067 unspecified role unspecified role prey prey Region 93-470 Region 93-470 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false magoh-pym1-2 3165059 N/A 3165070 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3165066 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P61326:p.[Asp66Ala;Glu68Ala] D66A/E68A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P61326:p.[Glu72Ala;Asp73Ala] E72A/D73A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false upf2-upf1-11 3165060 N/A 3165068 unspecified role unspecified role prey prey Region 115-272 Region 115-272 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 1-294 Region 1-294 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165069 unspecified role unspecified role bait bait Region 770-1204 Region 770-1204 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false CBP-tag CBP-tag cam tag calmodulin binding protein tag cam tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false eif4a3-casc3-5 3165061 N/A 3165065 unspecified role unspecified role prey prey Region 50-174 Region 50-174 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165063 unspecified role unspecified role prey prey Region 137-283 Region 137-283 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165064 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3165066 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false upf1-upf2-12 3165062 N/A 3165068 unspecified role unspecified role unspecified role unspecified role Region 115-914 Region 115-914 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3165069 unspecified role unspecified role unspecified role unspecified role Region 770-1204 Region 770-1204 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false