DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ eguchi-2007-1 ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Eguchi Y., Itou J., Yamane M., Demizu R., Yamato F., Okada A., Mori H., Kato A., Utsumi R. DIP original experiment: DIP-111320X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx B1500, a small membrane protein, connects the two-component systems EvgS/EvgA and PhoQ/PhoP in Escherichia coli. Eguchi Y., Itou J., Yamane M., Demizu R., Yamato F., Okada A., Mori H., Kato A., Utsumi R. Only protein-protein interactions imex curation a1z2s2_ecolx Histidine kinase phoQ protein protein ecolx Escherichia coli MYQRKGVNISLDISPEISFVGEQNDFVEVMGNVLDNACKYCLEFVEISARQTDEHLYIVVEDDGPGIPLSKREVIFDRGQRVDTLRPGQGVGLAVAREITKQYEGKIVAGESMLGGARMEVIFGRQHSTPKDE safa_ecoli Two-component-system connector protein SafA safA Regulatory protein b1500 Sensor associating factor A yneN JW1494.1 b1500 protein protein ecoli Escherichia coli (strain K12) MHATTVKNKITQRDNYKEIMSAIVVVLLLTLTLIAIFSAIDQLSISEMGRIARDLTHFIINSLQG 10ECD1B9EE15463E b1500-phoq-1 3164131 N/A 3164132 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3164133 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false