DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zhang-2007-7 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhang Y., Chan DC. DIP original experiment: DIP-111314X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for recruitment of mitochondrial fission complexes by Fis1. Zhang Y., Chan DC. Only protein-protein interactions imex curation zhang-2007-8 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhang Y., Chan DC. DIP original experiment: DIP-111312X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for recruitment of mitochondrial fission complexes by Fis1. Zhang Y., Chan DC. Only protein-protein interactions imex curation zhang-2007-9 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Zhang Y., Chan DC. DIP original experiment: DIP-111318X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for recruitment of mitochondrial fission complexes by Fis1. Zhang Y., Chan DC. Only protein-protein interactions imex curation zhang-2007-10 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang Y., Chan DC. DIP original experiment: DIP-111316X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for recruitment of mitochondrial fission complexes by Fis1. Zhang Y., Chan DC. Only protein-protein interactions imex curation zhang-2007-11 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang Y., Chan DC. DIP original experiment: DIP-111319X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for recruitment of mitochondrial fission complexes by Fis1. Zhang Y., Chan DC. Only protein-protein interactions imex curation zhang-2007-12 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhang Y., Chan DC. DIP original experiment: DIP-111315X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for recruitment of mitochondrial fission complexes by Fis1. Zhang Y., Chan DC. Only protein-protein interactions imex curation zhang-2007-13 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhang Y., Chan DC. DIP original experiment: DIP-111313X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for recruitment of mitochondrial fission complexes by Fis1. Zhang Y., Chan DC. Only protein-protein interactions imex curation zhang-2007-14 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang Y., Chan DC. DIP original experiment: DIP-111317X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for recruitment of mitochondrial fission complexes by Fis1. Zhang Y., Chan DC. Only protein-protein interactions imex curation caf4_yeast CCR4-associated factor 4 YKR036C CAF4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGSGDTRGESSLVAKPIEIILNKLPHAILAQQQFQKYITSPIYRYLSKLLLFREVAWPESTKDTQKGQVGIFSFQNNYADSATTFRILAHLDEQRYPLPNGAAEKNLPSLFEGFKATVSIIQQRLLLDNVDGATNSDKEKYVQLPDINTGFVNKTYSRIDLTHLLEDVETNVENLSINKTLEMDELTRLDSMINELESRKLKILERVKHIDSKSTNLENDVTLIKDRINFIEEYNLEADREQSLRKQMEEERSSEASSFTQNEEAISSLCDVESKDTRLKDFYKMPHEKSHDKNRQIISETYSRNTTAFRMTIPHGEHGNSITALDFDTPWGTLCSSSYQDRIVKVWDLNHGIQVGELPGHLATVNCMQIDKKNYNMLITGSKDATLKLWDLNLSREIYLDHSPLKEKTEEIVTPCIHNFELHKDEITALSFDSEALVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPARSLNNGACLLGTEAPMIGALQCYNSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKFDSEKLVTGSMDNSVRIWDLRTSSILDVIAYDLPVSSLDFDGKLITVGANEGGVNVFNMERDEHWMTPEPPHSLDGDELSRRIAIVKYKDGFLINGHNDGDINVWTL 2C6B472CCC2340D3 fis1_yeast Mitochondrial fission 1 protein Mitochondrial division protein 2 FIS1 MDV2 YIL065C protein protein yeast Saccharomyces cerevisiae Baker's yeast MTKVDFWPTLKDAYEPLYPQQLEILRQQVVSEGGPTATIQSRFNYAWGLIKSTDVNDERLGVKILTDIYKEAESRRRECLYYLTIGCYKLGEYSMAKRYVDTLFEHERNNKQVGALKSMVEDKIQKETLKGVVVAGGVLAGAVAVASFFLRNKRR BD62D19524770536 mdv1_yeast Mitochondrial division protein 1 YJL112W J0802 MDV1 FIS2 GAG3 NET2 Mitochondria fission 2 protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MSVNDQITHIGKTLSTTASAFLNYQKSNSNTQDVLTNNGPYKNLLSNTVNNASSTSYFYKRTEHGRFVKNASNTFEDIYSKTRRGDVFRNKFTDNKTCFRMLTYISDDLLNEIPTKEGLKSDADGKLLTEGGENENLRKNASKKETSLFQGFKSYLPIAELAIENTERLNYDTNGTSGTVGAKDVMSKTNERDEIHTELPNFQDSFLIPPGVETKKISSSYSPSALKSFSQTLVNSLEFLNIQKNSTLSEIRDIEVEVENLRQKKEKLLGKIANIEQNQLLLEDNLKQIDDRLDFLEEYGLEVIEANSDENAEDDGMSERKALKNDAIRNEGVTTESISSEASNLPPRRRQQLRDDNSLNRLGAFYSKSKKRHRKSFPTFQQLYEPGTKIGSIMSTHDDFLTCLDFDAPFGTLCTAGYLDHTVKIWDLSKQNKIGELAGHLATINCMQINRDYGTLVTGGRDAALKLWNLNLAQQLYQETQNLTSPTNHIDSPCVHTFEAHTDEVTALSLDPSFLVSGSQDRTIRQWDLRSGKCLQTIDLSFANVLTTSTNVDLSKSTLLTQRNERPSIGALQSFDAALATGTKDGVVRLWDLRSGKVIRTLKGHTDAITSLKFDSACLVTGSYDRTVRIWDLRTGLLNKFHAYSAPVLSLDLFQENAAVVVADEPSVQIYDSEKDESWSCVEQGNETSVSTVKYKENYMVEGRENGDVNIWAV CA8A23DBB06193A6 caf4-fis1-1 3164067 N/A 3164075 unspecified role unspecified role unspecified role unspecified role Region 81-140 Region 81-140 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3164076 unspecified role unspecified role unspecified role unspecified role Region 1-129 Region 1-129 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false fis1-mdv1-1 3164068 N/A 3164076 unspecified role unspecified role unspecified role unspecified role Region 1-129 Region 1-129 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3164077 unspecified role unspecified role unspecified role unspecified role Region 122-171 Region 122-171 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false fis1-mdv1-2 3164069 N/A 3164076 unspecified role unspecified role bait bait P40515:p.[Phe43Ala;Asn44Ala] F43A/N44A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P40515:p.Trp47Ala W47A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P40515:p.[Ile24Ala;Leu25Ala] I24A/L25A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3164077 unspecified role unspecified role prey prey P47025:p.Leu148Ala L148A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P47025:p.Phe149Ala F149A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P47025:p.Phe152Ala F152A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P47025:p.[Phe99Ala;Arg100Ala] F99A/R100A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P47025:p.Ile105Ala I105A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false mdv1-fis1-1 3164070 N/A 3164076 unspecified role unspecified role prey prey Region 1-127 Region 1-127 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3164077 unspecified role unspecified role bait bait Binding region 88-164 Binding region 88-164 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false fis1-caf4-1 3164071 N/A 3164075 unspecified role unspecified role prey prey P36130:p.Leu110Ala L126A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P36130:p.Phe111Ala F127A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P36130:p.Phe114Ala F130A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P36130:p.Phe85_Arg86delinsAlaAla F101A/R102A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P36130:p.Leu88Ala L107A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3164076 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false caf4-fis1-2 3164072 N/A 3164075 unspecified role unspecified role unspecified role unspecified role Region 81-140 Region 81-140 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3164076 unspecified role unspecified role unspecified role unspecified role Region 1-129 Region 1-129 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false fis1-mdv1-3 3164073 N/A 3164076 unspecified role unspecified role unspecified role unspecified role Region 1-129 Region 1-129 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3164077 unspecified role unspecified role unspecified role unspecified role Region 122-171 Region 122-171 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false caf4-fis1-3 3164074 N/A 3164075 unspecified role unspecified role bait bait Binding region 90-142 Binding region 90-142 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3164076 unspecified role unspecified role prey prey Region 1-127 Region 1-127 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false