DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ mathews-2007-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Mathews FS., Gordon MM., Chen Z., Rajashankar KR., Ealick SE., Alpers DH., Sukumar N. DIP original experiment: DIP-111374X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Crystal structure of human intrinsic factor: cobalamin complex at 2.6-A resolution. Mathews FS., Gordon MM., Chen Z., Rajashankar KR., Ealick SE., Alpers DH., Sukumar N. Only protein-protein interactions imex curation if_human Cobalamin binding intrinsic factor CBLIF GIF Gastric intrinsic factor IFMH Intrinsic factor protein protein human Homo sapiens Human MAWFALYLLSLLWATAGTSTQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSNPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY gif-gif-1 3163378 N/A 3163379 unspecified role unspecified role unspecified role unspecified role picpa Pichia pastoris (Yeast) Yeast Pichia pastoris N/A 3163379 unspecified role unspecified role unspecified role unspecified role picpa Pichia pastoris (Yeast) Yeast Pichia pastoris direct interaction direct interaction false false false