DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ baker-2007-2 ecolx Escherichia coli comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Baker KA., Tzitzilonis C., Kwiatkowski W., Choe S., Riek R. DIP original experiment: DIP-68102X Nature structural & molecular biology 2007 IMEx Conformational dynamics of the KcsA potassium channel governs gating properties. Baker KA., Tzitzilonis C., Kwiatkowski W., Choe S., Riek R. Only protein-protein interactions imex curation baker-2007-3 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Baker KA., Tzitzilonis C., Kwiatkowski W., Choe S., Riek R. DIP original experiment: DIP-68103X Nature structural & molecular biology 2007 IMEx Conformational dynamics of the KcsA potassium channel governs gating properties. Baker KA., Tzitzilonis C., Kwiatkowski W., Choe S., Riek R. Only protein-protein interactions imex curation kcsa_strli pH-gated potassium channel KcsA Streptomyces lividans K+ channel kcsA skc1 protein protein strli Streptomyces lividans MPPMLSGLLARLVKLLLGRHGSALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGHFVRHSEKAAEEAYTRTTRALHERFDRLERMLDDNRR mint kcsa-2 3162429 N/A 3162431 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction false false false kcsa-3 3162430 N/A 3162431 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction false false false