DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ jasti-2007-1 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Jasti J., Furukawa H., Gonzales EB., Gouaux E. DIP original experiment: DIP-253110X Nature 2007 IMEx Structure of acid-sensing ion channel 1 at 1.9 A resolution and low pH. Jasti J., Furukawa H., Gonzales EB., Gouaux E. Only protein-protein interactions imex curation jasti-2007-2 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Jasti J., Furukawa H., Gonzales EB., Gouaux E. DIP original experiment: DIP-253107X Nature 2007 IMEx Structure of acid-sensing ion channel 1 at 1.9 A resolution and low pH. Jasti J., Furukawa H., Gonzales EB., Gouaux E. Only protein-protein interactions imex curation jasti-2007-3 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm crosslink cross-linking study crosslink predetermined predetermined participant predetermined Jasti J., Furukawa H., Gonzales EB., Gouaux E. DIP original experiment: DIP-253108X Nature 2007 IMEx Structure of acid-sensing ion channel 1 at 1.9 A resolution and low pH. Jasti J., Furukawa H., Gonzales EB., Gouaux E. Only protein-protein interactions imex curation jasti-2007-4 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm light scattering light scattering predetermined predetermined participant predetermined Jasti J., Furukawa H., Gonzales EB., Gouaux E. DIP original experiment: DIP-253109X Nature 2007 IMEx Structure of acid-sensing ion channel 1 at 1.9 A resolution and low pH. Jasti J., Furukawa H., Gonzales EB., Gouaux E. Only protein-protein interactions imex curation asic1_chick Acid-sensing ion channel 1 ASIC1 ACCN2 Amiloride-sensitive cation channel 2, neuronal protein protein chick Gallus gallus (Chicken) Chicken MMDLKVDEEEVDSGQPVSIQAFASSSTLHGISHIFSYERLSLKRVVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHRLCRRGKCRKNHKRNNTDKGVALSMDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC asic1-1 3161478 N/A 3161482 unspecified role unspecified role unspecified role unspecified role Region 26-463 Region 26-463 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false asic1-2 3161479 N/A 3161482 unspecified role unspecified role unspecified role unspecified role Region 26-463 Region 26-463 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false asic1-3 3161480 N/A 3161482 unspecified role unspecified role unspecified role unspecified role Region 26-463 Region 26-463 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false asic1-4 3161481 N/A 3161482 unspecified role unspecified role unspecified role unspecified role Region 26-463 Region 26-463 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false