DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ krimpenfort-2007-1 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Krimpenfort P., Ijpenberg A., Song JY., van der Valk M., Nawijn M., Zevenhoven J., Berns A. DIP original experiment: DIP-253137X Nature 2007 IMEx p15Ink4b is a critical tumour suppressor in the absence of p16Ink4a. Krimpenfort P., Ijpenberg A., Song JY., van der Valk M., Nawijn M., Zevenhoven J., Berns A. Only protein-protein interactions imex curation krimpenfort-2007-2 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Krimpenfort P., Ijpenberg A., Song JY., van der Valk M., Nawijn M., Zevenhoven J., Berns A. DIP original experiment: DIP-253138X Nature 2007 IMEx p15Ink4b is a critical tumour suppressor in the absence of p16Ink4a. Krimpenfort P., Ijpenberg A., Song JY., van der Valk M., Nawijn M., Zevenhoven J., Berns A. Only protein-protein interactions imex curation cdn2a_mouse Cyclin-dependent kinase inhibitor 2A Cdkn2a P16ink4a Cyclin-dependent kinase 4 inhibitor A p16-INK4a protein protein mouse Mus musculus Mouse MESAADRLARAAAQGRVHDVRALLEAGVSPNAPNSFGRTPIQVMMMGNVHVAALLLNYGADSNCEDPTTFSRPVHDAAREGFLDTLVVLHGSGARLDVRDAWGRLPLDLAQERGHQDIVRYLRSAGCSLCSAGWSLCTAGNVAQTDGHSFSSSTPRALELRGQSQEQS cdk4_mouse Cyclin-dependent kinase 4 Cell division protein kinase 4 PSK-J3 CRK3 Cdk4 Crk3 protein protein mouse Mus musculus Mouse MAATRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAAGGGLPVSTVREVALLRRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDLMRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPREVSLPRGAFAPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKEESDAE cdn2c_mouse Cyclin-dependent kinase 4 inhibitor C Cdkn2c Cyclin-dependent kinase 6 inhibitor p18-INK4c p18-INK6 protein protein mouse Mus musculus Mouse MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPNLKDGTGFAVIHDAARAGFLDTVQALLEFQADVNIEDNEGNLPLHLAAKEGHLPVVEFLMKHTACNVGHRNHKGDTAFDLARFYGRNEVISLMEANGVGGATSLQ cdn2b_mouse Cyclin-dependent kinase 4 inhibitor B Cdkn2b p14-INK4b p15-INK4b protein protein mouse Mus musculus Mouse MLGGSSDAGLATAAARGQVETVRQLLEAGADPNALNRFGRRPIQVMMMGSAQVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVCDAWGRLPVDLAEEQGHRDIARYLHAATGD cdk4-cdkn2a-8 3160250 N/A 3160252 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3160253 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3160254 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association false false false cdk4-cdkn2b-8 3160251 N/A 3160255 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3160253 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3160254 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association false false false