DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ bisgrove-2007-1 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-113934X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions imex curation bisgrove-2007-2 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-113939X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions imex curation bisgrove-2007-3 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-113937X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions imex curation bisgrove-2007-4 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-113935X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions imex curation bisgrove-2007-5 in vitro In vitro pull down pull down autoradiography autoradiography Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-113940X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions imex curation bisgrove-2007-6 in vitro In vitro pull down pull down autoradiography autoradiography Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-113938X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions imex curation bisgrove-2007-7 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-113936X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions imex curation bisgrove-2007-8 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-260783X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions imex curation bisgrove-2007-9 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-260784X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions imex curation bisgrove-2007-10 in vitro In vitro pull down pull down autoradiography autoradiography Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-260785X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions imex curation bisgrove-2007-11 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-260786X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions imex curation bisgrove-2007-12 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-260787X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions imex curation bisgrove-2007-13 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-260788X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions imex curation bisgrove-2007-14 in vitro In vitro pull down pull down autoradiography autoradiography Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-260789X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions imex curation ccnt1_human Cyclin-T1 CCNT1 protein protein human Homo sapiens Human MEGERKNNNKRWYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFYMIQSFTQFPGNSVAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPDTRSEAYLQQVQDLVILESIILQTLGFELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATNSLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHEFLQILEKTPNRLKRIWNWRACEAAKKTKADDRGTDEKTSEQTILNMISQSSSDTTIAGLMSMSTSTTSAVPSLPVSEESSSNLTSVEMLPGKRWLSSQPSFKLEPTQGHRTSENLALTGVDHSLPQDGSNAFISQKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENMEANVKSQYAYAAQNLLSHHDSHSSVILKMPIEGSENPERPFLEKADKTALKMRIPVAGGDKAASSKPEEIKMRIKVHAAADKHNSVEDSVTKSREHKEKHKTHPSNHHHHHNHHSHKHSHSQLPVGTGNKRPGDPKHSSQTSNLAHKTYSLSSSFSSSSSTRKRGPSEETGGAVFDHPAKIAKSTKSSSLNFSFPSLPTMGQMPGHSSDTSGLSFSQPSCKTRVPHSKLDKGPTGANGHNTTQTIDYQDTVNMLHSLLSAQGVQPTQPTAFEFVRPYSDYLNPRSGGISSRSGNTDKPRPPPLPSEPPPPLPPLPK o60885-1 Bromodomain-containing protein 4 Brd4L Long BRD4 HUNK1 Protein HUNK1 protein protein human Homo sapiens Human MSAESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRGRGRKETGTAKPGVSTVPNTTQASTPPQTQTPQPNPPPVQATPHPFPAVTPDLIVQTPVMTVVPPQPLQTPPPVPPQPQPPPAPAPQPVQSHPPIIAATPQPVKTKKGVKRKADTTTPTTIDPIHEPPSLPPEPKTTKLGQRRESSRPVKPPKKDVPDSQQHPAPEKSSKVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVAVSSPAVPPPTKVVAPPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKKEKDKKEKKKEKHKRKEEVEENKKSKAKEPPPKKTKKNNSSNSNVSKKEPAPMKSKPPPTYESEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESSSESSSSDSEDSETEMAPKSKKKGHPGREQKKHHHHHHQQMQQAPAPVPQQPPPPPQQPPPPPPPQQQQQPPPPPPPPSMPQQAAPAMKSSPPPFIATQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLPQPPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPARPPAVSPALTQTPLLPQPPMAQPPQVLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPLPPPPHPSVQQQLQQQPPPPPPPQPQPPPQQQHQPPPRPVHLQPMQFSTHIQQPPPPQGQQPPHPPPGQQPPPPQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLTHQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPPGAPDKDKQKQEPKTPVAPKKDLKIKNMGSWASLVQKHPTTPSSTAKSSSDSFEQFRRAAREKEEREKALKAQAEHAEKEKERLRQERMRSREDEDALEQARRAHEEARRRQEQQQQQRQEQQQQQQQQAAAVAAAATPQAQSSQPQSMLDQQRELARKREQERRRREAMAATIDMNFQSDLLSIFEENLF cdk9_human Cyclin-dependent kinase 9 CDK9 CDC2L4 Cell division protein kinase 9 Serine/threonine-protein kinase PITALRE Cell division cycle 2-like protein kinase 4 C-2K TAK Tat-associated kinase complex catalytic subunit protein protein human Homo sapiens Human MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF brd4-ccnt1-1 3159610 N/A 3159624 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3159625 unspecified role unspecified role bait bait flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false brd4-ccnt1-2 3159611 N/A 3159624 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3159625 unspecified role unspecified role bait bait O60885-1:p.Arg1337Pro R1337P mutation disrupting mutation disrupting interaction mutation disrupting predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false brd4-cdk9-1 3159612 N/A 3159626 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3159625 unspecified role unspecified role bait bait O60885-1:p.Arg1337Pro R1337P mutation disrupting mutation disrupting interaction mutation disrupting predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false brd4-cdk9-2 3159613 N/A 3159626 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3159625 unspecified role unspecified role bait bait 722-1362 722-1362 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false brd4-cdk9-3 3159614 N/A 3159626 unspecified role unspecified role prey prey in vitro In vitro N/A 3159625 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 1209-1362 1209-1362 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false brd4-ccnt1-3 3159615 N/A 3159624 unspecified role unspecified role prey prey in vitro In vitro N/A 3159625 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 1209-1362 1209-1362 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false brd4-cdk9-4 3159616 N/A 3159626 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3159625 unspecified role unspecified role bait bait deletion 1329-1362, 1329-1345, 1345-1362 deletion 1329-1362, 1329-1345, 1345-1362 required to bind necessary binding region required to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false brd4-ccnt1-4 3159617 N/A 3159624 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3159625 unspecified role unspecified role bait bait flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false 1 nodeMerge04 2014-06-25 brd4-ccnt1-5 3159618 N/A 3159624 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3159625 unspecified role unspecified role bait bait O60885-1:p.Arg1337Pro R1337P mutation disrupting mutation disrupting interaction mutation disrupting predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false 1 nodeMerge04 2014-06-25 brd4-ccnt1-6 3159619 N/A 3159624 unspecified role unspecified role prey prey in vitro In vitro N/A 3159625 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 1209-1362 1209-1362 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false 1 nodeMerge04 2014-06-25 brd4-cdk9-5 3159620 N/A 3159626 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3159625 unspecified role unspecified role bait bait deletion 1329-1362, 1329-1345, 1345-1362 deletion 1329-1362, 1329-1345, 1345-1362 required to bind necessary binding region required to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false 1 nodeMerge04 2014-06-25 brd4-cdk9-6 3159621 N/A 3159626 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3159625 unspecified role unspecified role bait bait O60885-1:p.Arg1337Pro R1337P mutation disrupting mutation disrupting interaction mutation disrupting predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false 1 nodeMerge04 2014-06-25 brd4-cdk9-7 3159622 N/A 3159626 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3159625 unspecified role unspecified role bait bait 722-1362 722-1362 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false 1 nodeMerge04 2014-06-25 brd4-cdk9-8 3159623 N/A 3159626 unspecified role unspecified role prey prey in vitro In vitro N/A 3159625 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 1209-1362 1209-1362 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false 1 nodeMerge04 2014-06-25