DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ van-2007-2 rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot van Niekerk EA., Willis DE., Chang JH., Reumann K., Heise T., Twiss JL. DIP original experiment: DIP-113975X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Sumoylation in axons triggers retrograde transport of the RNA-binding protein La. van Niekerk EA., Willis DE., Chang JH., Reumann K., Heise T., Twiss JL. Only protein-protein interactions imex curation van-2007-3 rat Rattus norvegicus (Rat) Rat anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western van Niekerk EA., Willis DE., Chang JH., Reumann K., Heise T., Twiss JL. DIP original experiment: DIP-113980X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Sumoylation in axons triggers retrograde transport of the RNA-binding protein La. van Niekerk EA., Willis DE., Chang JH., Reumann K., Heise T., Twiss JL. Only protein-protein interactions imex curation van-2007-4 rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined van Niekerk EA., Willis DE., Chang JH., Reumann K., Heise T., Twiss JL. DIP original experiment: DIP-113978X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Sumoylation in axons triggers retrograde transport of the RNA-binding protein La. van Niekerk EA., Willis DE., Chang JH., Reumann K., Heise T., Twiss JL. Only protein-protein interactions imex curation van-2007-5 rat Rattus norvegicus (Rat) Rat anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western van Niekerk EA., Willis DE., Chang JH., Reumann K., Heise T., Twiss JL. DIP original experiment: DIP-113976X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Sumoylation in axons triggers retrograde transport of the RNA-binding protein La. van Niekerk EA., Willis DE., Chang JH., Reumann K., Heise T., Twiss JL. Only protein-protein interactions imex curation van-2007-6 rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined van Niekerk EA., Willis DE., Chang JH., Reumann K., Heise T., Twiss JL. DIP original experiment: DIP-113979X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Sumoylation in axons triggers retrograde transport of the RNA-binding protein La. van Niekerk EA., Willis DE., Chang JH., Reumann K., Heise T., Twiss JL. Only protein-protein interactions imex curation van-2007-7 rat Rattus norvegicus (Rat) Rat anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot van Niekerk EA., Willis DE., Chang JH., Reumann K., Heise T., Twiss JL. DIP original experiment: DIP-113977X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Sumoylation in axons triggers retrograde transport of the RNA-binding protein La. van Niekerk EA., Willis DE., Chang JH., Reumann K., Heise T., Twiss JL. Only protein-protein interactions imex curation sumo1_rat Small ubiquitin-related modifier 1 Sumo1 protein protein rat Rattus norvegicus (Rat) Rat MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV mint Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Involved in targeting RANGAP1 to the nuclear pore complex protein RANBP2. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4 la_rat Lupus La protein homolog Ssb Ss-b La autoantigen homolog La ribonucleoprotein protein protein rat Rattus norvegicus (Rat) Rat MAENGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLETMIKFNRLNRLTTDFNVIVQALSKSKANLMEVSADKTKIRRSPSRPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLDDKGQILNIQMRRTLHKTFKGSIFAVFDSIQSAKKFVDTPGQKYKDTNLLILFKEDYFAKKNEERKQSKVEAKLKAKQEHEGRHKPGSTETRALEGKMGCLLKFSGDLDDQTCREDFHFLFSNHGEIKWIDFVRGAKEGIILFKEKAKDALEKARSANNGNLLLRNKKVTWKVLEGHAEKDAMKKITDDQQESLNKWKSKGGHAARRFKGSHVFTAARRFKGRGKGNRPAYAGAPKGRGQFQGRRTRFDDDDHRRGPVKRGIDGRDREEPASKHKKRENGARDK sumo2_rat Small ubiquitin-related modifier 2 Sumo2 Smt3a Smt3h2 SMT3 homolog 2 Sentrin-2 Ubiquitin-like protein SMT3A protein protein rat Rattus norvegicus (Rat) Rat MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY kinh_rat Kinesin-1 heavy chain Kif5b Ubiquitous kinesin heavy chain Conventional kinesin heavy chain Khc protein protein rat Rattus norvegicus (Rat) Rat MADPAECNIKVMCRFRPLNESEVNRGDKYVAKFQGEDTVMIASKPYAFDRVFQSSTSQEQVYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFNYIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVCSPDEVMDTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNCRTTIVICCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTAEQWKKKYEKEKEKNKTLRNTIQWLENELNRWRNGETVPIDEQFDKEKANLEAFTADKDVAITNDKPAAAIGMAGSFTDAERRKCEEEIAKLYKQLDDKDEEINQQSQLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIGIAVGNNDVKQPEGTGMIDEEFTVARLYISKMKSEVKTMVKRCKQLESTQTESNKKMEENEKELAACQLRISQHEAKIKSLTEYLQNVEQKKRQLEESVDSLGEELVQLRAQEKVHEMEKEHLNKVQTANEVKQAVEQQIQSHRETHQKQISSLRDEVEAKEKLITDLQDQNQKMVLEQERLRVEHERLKAVDQEKSRKLHELTVMQDRREQARQDLKGLEETVAKELQTLHNLRKLFVQDLATRVKKSAEVDSDDTGGSAAQKQKISFLENNLEQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENASRDRKRYQQEVDRIKEAVRSKNMARRGHSAQIAKPIRPGQHPAASPTHPGAVRGGGSFVQNNQPVGLRGGGGKQA la_human Lupus La protein SSB Sjoegren syndrome type B antigen La ribonucleoprotein La autoantigen protein protein human Homo sapiens Human MAENGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKKNEERKQNKVEAKLRAKQEQEAKQKLEEDAEMKSLEEKIGCLLKFSGDLDDQTCREDLHILFSNHGEIKWIDFVRGAKEGIILFKEKAKEALGKAKDANNGNLQLRNKEVTWEVLEGEVEKEALKKIIEDQQESLNKWKSKGRRFKGKGKGNKAAQPGSGKGKVQFQGKKTKFASDDEHDEHDENGATGPVKRAREETDKEEPASKQQKTENGAGDQ ssb-sumo1-1 3159203 N/A 3159209 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat N/A 3159210 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat physical association physical association false false false sumo2-ssb-1 3159204 N/A 3159211 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false rat Rattus norvegicus (Rat) Rat N/A 3159210 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat physical association physical association false false false kif5b-ssb-1 3159205 N/A 3159212 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat N/A 3159210 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat physical association physical association false false false sumo1-ssb-1 3159206 N/A 3159209 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false rat Rattus norvegicus (Rat) Rat N/A 3159210 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat physical association physical association false false false sumo1-ssb-2 3159207 N/A 3159209 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat N/A 3159210 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat physical association physical association false false false ssb-sumo1-2 3159208 N/A 3159209 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat N/A 3159213 unspecified role unspecified role bait bait P05455:p.Lys41Arg K41R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P05455:p.[Lys41Arg;Lys185Arg;Lys208Arg] K41R/K185R/K208R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false rat Rattus norvegicus (Rat) Rat physical association physical association false false false