DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ liu-2007-10 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu Z., Wu J., Yu X. DIP original experiment: DIP-68083X Nature structural & molecular biology 2007 IMEx CCDC98 targets BRCA1 to DNA damage sites. Liu Z., Wu J., Yu X. Only protein-protein interactions imex curation liu-2007-11 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu Z., Wu J., Yu X. DIP original experiment: DIP-68084X Nature structural & molecular biology 2007 IMEx CCDC98 targets BRCA1 to DNA damage sites. Liu Z., Wu J., Yu X. Only protein-protein interactions imex curation liu-2007-12 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Liu Z., Wu J., Yu X. DIP original experiment: DIP-68086X Nature structural & molecular biology 2007 IMEx CCDC98 targets BRCA1 to DNA damage sites. Liu Z., Wu J., Yu X. Only protein-protein interactions imex curation liu-2007-13 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu Z., Wu J., Yu X. DIP original experiment: DIP-68081X Nature structural & molecular biology 2007 IMEx CCDC98 targets BRCA1 to DNA damage sites. Liu Z., Wu J., Yu X. Only protein-protein interactions imex curation liu-2007-14 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu Z., Wu J., Yu X. DIP original experiment: DIP-68088X Nature structural & molecular biology 2007 IMEx CCDC98 targets BRCA1 to DNA damage sites. Liu Z., Wu J., Yu X. Only protein-protein interactions imex curation liu-2007-15 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu Z., Wu J., Yu X. DIP original experiment: DIP-68087X Nature structural & molecular biology 2007 IMEx CCDC98 targets BRCA1 to DNA damage sites. Liu Z., Wu J., Yu X. Only protein-protein interactions imex curation liu-2007-16 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Liu Z., Wu J., Yu X. DIP original experiment: DIP-68085X Nature structural & molecular biology 2007 IMEx CCDC98 targets BRCA1 to DNA damage sites. Liu Z., Wu J., Yu X. Only protein-protein interactions imex curation liu-2007-17 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu Z., Wu J., Yu X. DIP original experiment: DIP-68082X Nature structural & molecular biology 2007 IMEx CCDC98 targets BRCA1 to DNA damage sites. Liu Z., Wu J., Yu X. Only protein-protein interactions imex curation q96rl1-1 BRCA1-A complex subunit RAP80 UIMC1 RXRIP110 Receptor-associated protein 80 Retinoid X receptor-interacting protein 110 Ubiquitin interaction motif-containing protein 1 RAP80 protein protein human Homo sapiens Human MPRRKKKVKEVSESRNLEKKDVETTSSVSVKRKRRLEDAFIVISDSDGEEPKEENGLQKTKTKQSNRAKCLAKRKIAQMTEEEQFALALKMSEQEAREVNSQEEEEEELLRKAIAESLNSCRPSDASATRSRPLATGPSSQSHQEKTTDSGLTEGIWQLVPPSLFKGSHISQGNEAEEREEPWDHTEKTEEEPVSGSSGSWDQSSQPVFENVNVKSFDRCTGHSAEHTQCGKPQESTGRGSAFLKAVQGSGDTSRHCLPTLADAKGLQDTGGTVNYFWGIPFCPDGVDPNQYTKVILCQLEVYQKSLKMAQRQLLNKKGFGEPVLPRPPSLIQNECGQGEQASEKNECISEDMGDEDKEERQESRASDWHSKTKDFQESSIKSLKEKLLLEEEPTTSHGQSSQGIVEETSEEGNSVPASQSVAALTSKRSLVLMPESSAEEITVCPETQLSSSETFDLEREVSPGSRDILDGVRIIMADKEVGNKEDAEKEVAISTFSSSNQVSCPLCDQCFPPTKIERHAMYCNGLMEEDTVLTRRQKEAKTKSDSGTAAQTSLDIDKNEKCYLCKSLVPFREYQCHVDSCLQLAKADQGDGPEGSGRACSTVEGKWQQRLKNPKEKGHSEGRLLSFLEQSEHKTSDADIKSSETGAFRVPSPGMEEAGCSREMQSSFTRRDLNESPVKSFVSISEATDCLVDFKKQVTVQPGSRTRTKAGRGRRRKF abrx1_human BRCA1-A complex subunit Abraxas 1 ABRAXAS1 ABRA1 CCDC98 Coiled-coil domain-containing protein 98 FAM175A Protein FAM175A UNQ496/PRO1013 protein protein human Homo sapiens Human MEGESTSAVLSGFVLGALAFQHLNTDSDTEGFLLGEVKGEAKNSITDSQMDDVEVVYTIDIQKYIPCYQLFSFYNSSGEVNEQALKKILSNVKKNVVGWYKFRRHSDQIMTFRERLLHKNLQEHFSNQDLVFLLLTPSIITESCSTHRLEHSLYKPQKGLFHRVPLVVANLGMSEQLGYKTVSGSCMSTGFSRAVQTHSSKFFEEDGSLKEVHKINEMYASLQEELKSICKKVEDSEQAVDKLVKDVNRLKREIEKRRGAQIQAAREKNIQKDPQENIFLCQALRTFFPNSEFLHSCVMSLKNRHVSKSSCNYNHHLDVVDNLTLMVEHTDIPEASPASTPQIIKHKALDLDDRWQFKRSRLLDTQDKRSKADTGSSNQDKASKMSSPETDEEIEKMKGFGEYSRSPTF This sequence has been withdrawn from Uniprot. brca1_human Breast cancer type 1 susceptibility protein BRCA1 RNF53 RING finger protein 53 RING-type E3 ubiquitin transferase BRCA1 protein protein human Homo sapiens Human MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQESTRFSQLVEELLKIICAFQLDTGLEYANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSLQETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYIELGSDSSEDTVNKATYCSVGDQELLQITPQGTRDEISLDSAKKAACEFSETDVTNTEHHQPSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSLQHENSSLLLTKDRMNVEKAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLNADPLCERKEWNKQKLPCSENPRDTEDVPWITLNSSIQKVNEWFSRSDELLGSDDSHDGESESNAKVADVLDVLNEVDEYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGKTYRKKASLPNLSHVTENLIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADLAVQKTPEMINQGTNQTEQNGQVMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTKAEPISSSISNMELELNIHNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDSCSSSEEIKKKKYNQMPVRHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPELKLTNAPGSFTKCSNTSELKEFVNPSLPREEKEEKLETVKVSNNAEDPKDLMLSGERVLQTERSVESSSISLVPGTDYGTQESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNRNDTEGFKYPLGHEVNHSRETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECATFSAHSGSLKKQSPKVTFECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSSQFRGNETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLEENFEEHSMSPEREMGNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIGSSDENIQAELGRNRGPKLNAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTDFSPYLISDNLEQPMGSSHASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHTHLAQGYRRGAKKLESSEENLSSEDEELPCFQHLLFGKVNNIPSQSTRHSTVATECLSKNTEENLLSLKNSLNDCSNQVILAKASQEHHLSEETKCSASLFSSQCSELEDLTANTNTQDPFLIGSSKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDSNLGEAASGCESETSVSEDCSGLSSQSDILTTQQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDSSALEDLRNPEQSTSEKAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVERSSPSKCPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSYLPRQDLEGTPYLESGISLFSDDPESDPSEDRAPESARVGNIPSSTSALKVPQLKVAESAQSPAAAHTTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY fam175a-uimc1-1 3159163 N/A 3159171 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3159172 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false uimc1-fam175a-1 3159164 N/A 3159171 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3159172 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false brca1-fam175a-1 3159165 N/A 3159173 unspecified role unspecified role bait bait 1599-1863 binding region 1599-1863 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3159172 unspecified role unspecified role prey prey Q6UWZ7:p.Ser406Ala S406A mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false brca1-fam175a-2 3159166 N/A 3159173 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3159172 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false uimc1-brca1-1 3159167 N/A 3159171 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3159173 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false brca1-uimc1-1 3159168 N/A 3159171 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3159173 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false brca1-fam175a-3 3159169 N/A 3159173 unspecified role unspecified role bait bait 1599-1863 binding region 1599-1863 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3159172 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false fam175a-brca1-1 3159170 N/A 3159173 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3159172 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false