DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ ruschak-2007-1 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Ruschak AM., Miranker AD. DIP original experiment: DIP-114005X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Fiber-dependent amyloid formation as catalysis of an existing reaction pathway. Ruschak AM., Miranker AD. Only protein-protein interactions imex curation ruschak-2007-2 in vitro In vitro x-ray fiber diffrac x-ray fiber diffraction X-ray X-ray x-ray fiber diffrac predetermined predetermined participant predetermined Ruschak AM., Miranker AD. DIP original experiment: DIP-114006X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx not sure about the method ID Ruschak AM., Miranker AD. Only protein-protein interactions imex curation iapp_human Islet amyloid polypeptide IAPP Amylin Diabetes-associated peptide Insulinoma amyloid peptide protein protein human Homo sapiens Human MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL not sure about the protein origin mint iapp-5 3159138 N/A 3159140 unspecified role unspecified role unspecified role unspecified role SNNFGAILSS SNNFGAILSS sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false iapp-4 3159139 N/A 3159140 unspecified role unspecified role unspecified role unspecified role in vitro In vitro direct interaction direct interaction false false false