DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hammer-2007-1 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Hammer ND., Schmidt JC., Chapman MR. DIP original experiment: DIP-113993X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The curli nucleator protein, CsgB, contains an amyloidogenic domain that directs CsgA polymerization. Hammer ND., Schmidt JC., Chapman MR. Only protein-protein interactions imex curation hammer-2007-2 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Hammer ND., Schmidt JC., Chapman MR. DIP original experiment: DIP-113994X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The curli nucleator protein, CsgB, contains an amyloidogenic domain that directs CsgA polymerization. Hammer ND., Schmidt JC., Chapman MR. Only protein-protein interactions imex curation hammer-2007-3 in vitro In vitro cd circular dichroism CD CD cd predetermined predetermined participant predetermined Hammer ND., Schmidt JC., Chapman MR. DIP original experiment: DIP-113995X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The curli nucleator protein, CsgB, contains an amyloidogenic domain that directs CsgA polymerization. Hammer ND., Schmidt JC., Chapman MR. Only protein-protein interactions imex curation hammer-2007-4 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Hammer ND., Schmidt JC., Chapman MR. DIP original experiment: DIP-113996X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The curli nucleator protein, CsgB, contains an amyloidogenic domain that directs CsgA polymerization. Hammer ND., Schmidt JC., Chapman MR. Only protein-protein interactions imex curation csgb_ecoli Minor curlin subunit csgB JW1024 b1041 protein protein ecoli Escherichia coli (strain K12) MKNKLLFMMLTILGAPGIAAAAGYDLANSEYNFAVNELSKSSFNQAAIIGQAGTNNSAQLRQGGSKLLAVVAQEGSSNRAKIDQTGDYNLAYIDQAGSANDASISQGAYGNTAMIIQKGSGNKANITQYGTQKTAIVVQRQSQMAIRVTQR B18D266B964014B8 csga_ecoli Major curlin subunit csgA JW1025 b1042 protein protein ecoli Escherichia coli (strain K12) MKLLKVAAIAAIVFSGSALAGVVPQYGGGGNHGGGGNNSGPNSELNIYQYGGGNSALALQTDARNSDLTITQHGGGNGADVGQGSDDSSIDLTQRGFGNSATLDQWNGKNSEMTVKQFGGGNGAAVDQTASNSSVNVTQVGFGNNATAHQY C003470D208D395F csga-csgb-1 3158874 N/A 3158878 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3158879 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false csgb-1 3158875 N/A 3158878 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false csgb-2 3158876 N/A 3158878 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false csgb-3 3158877 N/A 3158878 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false