DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ martinez-2007-1 picpa Pichia pastoris (Yeast) Yeast Pichia pastoris x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Martinez Molina D., Wetterholm A., Kohl A., McCarthy AA., Niegowski D., Ohlson E., Hammarberg T., Eshaghi S., Haeggström JZ., Nordlund P. DIP original experiment: DIP-253174X Nature 2007 IMEx Structural basis for synthesis of inflammatory mediators by human leukotriene C4 synthase. Martinez Molina D., Wetterholm A., Kohl A., McCarthy AA., Niegowski D., Ohlson E., Hammarberg T., Eshaghi S., Haeggström JZ., Nordlund P. Only protein-protein interactions imex curation ltc4s_human Leukotriene C4 synthase LTC4S Leukotriene-C(4) synthase Glutathione S-transferase LTC4 Leukotriene-C4 synthase protein protein human Homo sapiens Human MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA ltc4s-2 3158863 N/A 3158864 unspecified role unspecified role unspecified role unspecified role picpa Pichia pastoris (Yeast) Yeast Pichia pastoris direct interaction direct interaction false false false