DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dai-2007-4 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Dai S., Friemann R., Glauser DA., Bourquin F., Manieri W., Schürmann P., Eklund H. DIP original experiment: DIP-253195X Nature 2007 IMEx Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase. Dai S., Friemann R., Glauser DA., Bourquin F., Manieri W., Schürmann P., Eklund H. Only protein-protein interactions imex curation dai-2007-5 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Dai S., Friemann R., Glauser DA., Bourquin F., Manieri W., Schürmann P., Eklund H. DIP original experiment: DIP-253199X Nature 2007 IMEx Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase. Dai S., Friemann R., Glauser DA., Bourquin F., Manieri W., Schürmann P., Eklund H. Only protein-protein interactions imex curation dai-2007-6 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Dai S., Friemann R., Glauser DA., Bourquin F., Manieri W., Schürmann P., Eklund H. DIP original experiment: DIP-253196X Nature 2007 IMEx Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase. Dai S., Friemann R., Glauser DA., Bourquin F., Manieri W., Schürmann P., Eklund H. Only protein-protein interactions imex curation dai-2007-7 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Dai S., Friemann R., Glauser DA., Bourquin F., Manieri W., Schürmann P., Eklund H. DIP original experiment: DIP-253198X Nature 2007 IMEx Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase. Dai S., Friemann R., Glauser DA., Bourquin F., Manieri W., Schürmann P., Eklund H. Only protein-protein interactions imex curation dai-2007-8 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Dai S., Friemann R., Glauser DA., Bourquin F., Manieri W., Schürmann P., Eklund H. DIP original experiment: DIP-253197X Nature 2007 IMEx Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase. Dai S., Friemann R., Glauser DA., Bourquin F., Manieri W., Schürmann P., Eklund H. Only protein-protein interactions imex curation ftrc_syny3 Ferredoxin-thioredoxin reductase, catalytic chain ftrC Ferredoxin-thioredoxin reductase subunit B sll0554 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MTSSDTQNNKTLAAMKNFAEQYAKRTDTYFCSDLSVTAVVIEGLARHKEELGSPLCPCRHYEDKEAEVKNTFWNCPCVPMRERKECHCMLFLTPDNDFAGDAQDIPMETLEEVKASMA ftrv_syny3 Ferredoxin-thioredoxin reductase, variable chain ftrV Ferredoxin-thioredoxin reductase subunit A ssr0330 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MNVGDRVRVTSSVVVYHHPEHKKTAFDLQGMEGEVAAVLTEWQGRPISANLPVLVKFEQRFKAHFRPDEVTLIED trxm_spiol Thioredoxin M-type, chloroplastic protein protein spiol Spinacia oleracea (Spinach) Spinach MAIENCLQLSTSASVGTVAVKSHVHHLQPSSKVNVPTFRGLKRSFPALSSSVSSSSPRQFRYSSVVCKASEAVKEVQDVNDSSWKEFVLESEVPVMVDFWAPWCGPCKLIAPVIDELAKEYSGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAVPKSTLTDSIEKYLSP fer_syny3 Ferredoxin-1 Ferredoxin I petF fed ssl0020 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDLY trxf_spiol Thioredoxin F-type, chloroplastic protein protein spiol Spinacia oleracea (Spinach) Spinach MALHLSLSHQSWTSPAHPITSSDPTRSSVPGTGLSRRVDFLGSCKINGVFVVKRKDRRRMRGGEVRASMEQALGTQEMEAIVGKVTEVNKDTFWPIVKAAGDKPVVLDMFTQWCGPCKAMAPKYEKLAEEYLDVIFLKLDCNQENKTLAKELGIRVVPTFKILKENSVVGEVTGAKYDKLLEAIQAARSS ftrc-ftrv-1 3158578 N/A 3158583 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3158584 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ftrc-ftrv-2 3158579 N/A 3158585 unspecified role unspecified role unspecified role unspecified role Region 75-180 Region 75-180 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3158583 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3158584 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false ftrc-ftrv-3 3158580 N/A 3158586 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3158583 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3158584 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false ftrc-ftrv-4 3158581 N/A 3158587 unspecified role unspecified role unspecified role unspecified role Region 79-189 Region 79-189 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3158583 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3158584 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false ftrc-ftrv-5 3158582 N/A 3158587 unspecified role unspecified role unspecified role unspecified role Region 79-189 Region 79-189 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3158586 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3158583 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3158584 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false