IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ maleki-2007-1 yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Maleki S., Neale MJ., Arora C., Henderson KA., Keeney S. Yeast strains used carry the ndt80 mutation, which causes arrest of cells in prophase of meiosis I. s-keeney@ski.mskcc.org Chromosoma 2007 imex curation Only protein-protein interactions imex curation re114_yeast Meiotic recombination protein REC114 YM9375.02 YMR133W REC114 protein protein yeast Saccharomyces cerevisiae Baker's yeast MYEYCSVVIKKYSKYTIPSFAPNGFQSMLEPPQIDKWQHLSANCTLQFRVLLMDSRQILINVVLNNSTLLENIRLPLGDNQDLIQFSCKSPIISCKYISEEFGPRMLRRFQMNLPNDVEFNRTVVSLKNLNFVLRTARTSIAQSTITSQVQGNNNGTKVCFTEGPKVSSYTNPNTQFQTQNMIMDFSQRYQEESERESNNRSNITLPHDSIQIAQQIWPNTDLNVVQSSQDLNTPMATQTVLGRPESLIVQPLEVSQSPPNTTNCLPNAENKKKKVDTTSDFTSRKEIALCKTGLLETIHIPKERESQMQSVTGLDATPTIIWSPGKDNTAKKNTSNKKNIDDKLTNPQKSGNTHTPDRNKEVLPNGTLNETRKEASPSEGLTIRVKNVNRNASRKISKRLIKEKLKDEEFMKWVNKVETVLNKMFEK mei4_yeast Meiosis-specific protein MEI4 MEI4 YER044BC YER044C-A protein protein yeast Saccharomyces cerevisiae Baker's yeast MSRGKLEDMEQKETSEVDWIICFALIQSRNPTLWKRALSRKKGDVEDVGALKSEKNLKINPRENSKHIYKWVAPFENGFLNNKSLFAHLEPIYNFLCQNKYKSFEDAVGLKELQSFSKDVSTADINNWFLPRYKILLKILSLKTKEIDFRGLSQVFQTLQILLVSHYSHRIDSDSSFKRTLIDVHVFNFIAKFLFNRILLKKNQNDPKWLQNFYDQGDGKHLCDKVDYKRLCSLHFTLIYSIINIQLIKIKTNQTFEPQILKYVSVLKLIEHILIIIESLIHVLIRFVSKHKLICINRKKAYCRVYLERELSLKKTYLKNFYSVISGVPEKELGGLLKILKIVILSLLETFESIEWQHLKPFLEKFPAHEISLQKKRKYIQAALLITAERNLIARFRLSRWFNETENI to6bl_yeast Meiotic recombination protein REC102 L8543.17 YLR329W REC102 protein protein yeast Saccharomyces cerevisiae Baker's yeast MARDITFLTVFLESCGAVNNDEAGKLLSAWTSTVRIEGPESTDSNSLYIPLLPPGMLKIKLNFKMNDRLVTEEQELFTKLREIVGSSIRFWEEQLFYQVQDVSTIENHVILSLKCTILTDAQISTFISKPRELHTHAKGYPEIYYLSELSTTVNFFSKEGNYVEISQVIPHFNEYFSSLIVSQLEFEYPMVFSMISRLRLKWQQSSLAPISYALTSNSVLLPIMLNMIAQDKSSTTAYQILCRRRGPPIQNFQIFSLPAVTYNK re104_yeast Meiotic recombination protein REC104 REC104 YHR157W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSIEEEDTNKITCTQDFLHQYFVTERVSIQFGLNNKTVKRINKDEFDKAVNCIMSWTNYPKPGLKRTASTYLLSNSFKKSATVSLPFILGDPVCMPKRVESNNNDTCLLYSDTLYDDPLIQRNDQAGDEIEDEFSFTLLRSEVNEIRPISSSSTAQILQSDYSALMYERQASNGSIFQFSSP spo11_yeast Meiosis-specific protein SPO11 SPO11 Sporulation-specific protein 11 YHL022C protein protein yeast Saccharomyces cerevisiae Baker's yeast MALEGLRKKYKTRQELVKALTPKRRSIHLNSNGHSNGTPCSNADVLAHIKHFLSLAANSLEQHQQPISIVFQNKKKKGDTSSPDIHTTLDFPLNGPHLCTHQFKLKRCAILLNLLKVVMEKLPLGKNTTVRDIFYSNVELFQRQANVVQWLDVIRFNFKLSPRKSLNIIPAQKGLVYSPFPIDIYDNILTCENEPKMQKQTIFPGKPCLIPFFQDDAVIKLGTTSMCNIVIVEKEAVFTKLVNNYHKLSTNTMLITGKGFPDFLTRLFLKKLEQYCSKLISDCSIFTDADPYGISIALNYTHSNERNAYICTMANYKGIRITQVLAQNNEVHNKSIQLLSLNQRDYSLAKNLIASLTANSWDIATSPLKNVIIECQREIFFQKKAEMNEIDARIFEYK ski8_yeast Antiviral protein SKI8 YGL213C SKI8 REC103 Superkiller protein 8 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKVFIATANAGKAHDADIFSVSACNSFTVSCSGDGYLKVWDNKLLDNENPKDKSYSHFVHKSGLHHVDVLQAIERDAFELCLVATTSFSGDLLFYRITREDETKKVIFEKLDLLDSDMKKHSFWALKWGASNDRLLSHRLVATDVKGTTYIWKFHPFADESNSLTLNWSPTLELQGTVESPMTPSQFATSVDISERGLIATGFNNGTVQISELSTLRPLYNFESQHSMINNSNSIRSVKFSPQGSLLAIAHDSNSFGCITLYETEFGERIGSLSVPTHSSQASLGEFAHSSWVMSLSFNDSGETLCSAGWDGKLRFWDVKTKERITTLNMHCDDIEIEEDILAVDEHGDSLAEPGVFDVKFLKKGWRSGMGADLNESLCCVCLDRSIRWFREAGGK C5E7B9D2268F9727 re107_yeast Recombination protein 107 MER2 J1462 YJR021C REC107 Meiotic recombination protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVARGRTDEISTDVSEANSEHSLMITETSSPFRSIFSHSGKVANAGALEESDKQILEWAGKLELESMELRENSDKLIKVLNENSKTLCKSLNKFNQLLEQDAATNGNVKTLIKDLASQIENQLDKVSTAMLSKGDEKKTKSDSSYRQVLVEEISRYNSKITRHVTNKQHETEKSMRCTQEMLFNVGSQLEDVHKVLLSLSKDMHSLQTRQTALEMAFREKADHAYDRPDVSLNGTTLLHDMDEAHDKQRKKSVPPPRMMVTRSMKRRRSSSPTLSTSQNHNSEDNDDASHRLKRAARTIIPWEELRPDTLESEL 46F426AC0DFDFAD0 mei4-rec114-3 3322264 N/A 3322265 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3322266 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminal_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 4A mei4-rec114-4 3322264 N/A 3322265 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3322266 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 4C Both the N-terminal and C-terminal regions of Rec114 are sufficient by themselves to support interaction with Mei4. mei4-rec114-5 3322264 N/A 3322265 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3322267 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 5F rec102-rec114-1 3322264 N/A 3322268 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3322267 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 5E rec102-rec104-1 3322264 N/A 3322268 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N/A 3322267 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Figure 5Ei rec104-rec102-1 3322264 N/A 3322267 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3322268 unspecified role unspecified role ancillary ancillary physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3322269 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 6A spo11-rec102-1 3322264 N/A 3322268 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3322267 unspecified role unspecified role ancillary ancillary physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3322269 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 6B spo11-rec104-1 3322264 N/A 3322268 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3322267 unspecified role unspecified role ancillary ancillary physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3322270 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 6C ski8-rec104-1 3322264 N/A 3322268 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3322269 unspecified role unspecified role ancillary ancillary physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3322270 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 6C-2 The signal was reduced ∼2.5-fold in the Delta_rec114 strain. spo11-rec104-2 3322264 N/A 3322267 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3322265 unspecified role unspecified role ancillary ancillary physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3322266 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 6D mei4-rec102-1 3322264 N/A 3322267 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3322271 inhibitor inhibitor unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3322266 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 6D-2 Deletion of spo11 and rec104 reduced this interaction. mei4-rec102-2 3322264 N/A 3322268 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3322271 inhibitor inhibitor unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3322266 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 6E-4 mei4-rec102-3 3322264 N/A 3322268 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3322265 unspecified role unspecified role ancillary ancillary physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3322266 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 6E-3 mei4-rec104-1 3322264 N/A 3322268 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3322267 unspecified role unspecified role ancillary ancillary physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3322266 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 6E-1 mei4-rec104-2 3322264 N/A 3322268 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3322269 unspecified role unspecified role ancillary ancillary physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3322266 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 6E-2 mei4-rec114-6 3322264 N/A 3322265 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3322271 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 6F Mer2 still interacted with Rec114 in a mei4-delta strain, although with a LacZ signal reduced ∼ 2-fold. Similar two-hybrid signals were obtained in each of the other mutants tested, notably deletions of :- rec102, spo11 and rec104.