DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ tsai-2007-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Tsai Y., Sawaya MR., Cannon GC., Cai F., Williams EB., Heinhorst S., Kerfeld CA., Yeates TO. DIP original experiment: DIP-67878X PLoS biology 2007 IMEx Structural analysis of CsoS1A and the protein shell of the Halothiobacillus neapolitanus carboxysome. Tsai Y., Sawaya MR., Cannon GC., Cai F., Williams EB., Heinhorst S., Kerfeld CA., Yeates TO. Only protein-protein interactions imex curation csosa_halnc Major carboxysome shell protein CsoS1A csoS1A csoS1 Hneap_0915 protein protein halnc Halothiobacillus neapolitanus (strain ATCC 23641 / c2) Thiobacillus neapolitanus MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA F16D0BDF1AB1EACD csos1a-1 3156925 N/A 3156926 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false