DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ sun-2007-2 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Sun C., Song D., Davis-Taber RA., Barrett LW., Scott VE., Richardson PL., Pereda-Lopez A., Uchic ME., Solomon LR., Lake MR., Walter KA., Hajduk PJ., Olejniczak ET. DIP original experiment: DIP-261447X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Solution structure and mutational analysis of pituitary adenylate cyclase-activating polypeptide binding to the extracellular domain of PAC1-RS. Sun C., Song D., Davis-Taber RA., Barrett LW., Scott VE., Richardson PL., Pereda-Lopez A., Uchic ME., Solomon LR., Lake MR., Walter KA., Hajduk PJ., Olejniczak ET. Only protein-protein interactions imex curation sun-2007-3 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Sun C., Song D., Davis-Taber RA., Barrett LW., Scott VE., Richardson PL., Pereda-Lopez A., Uchic ME., Solomon LR., Lake MR., Walter KA., Hajduk PJ., Olejniczak ET. DIP original experiment: DIP-261448X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Solution structure and mutational analysis of pituitary adenylate cyclase-activating polypeptide binding to the extracellular domain of PAC1-RS. Sun C., Song D., Davis-Taber RA., Barrett LW., Scott VE., Richardson PL., Pereda-Lopez A., Uchic ME., Solomon LR., Lake MR., Walter KA., Hajduk PJ., Olejniczak ET. Only protein-protein interactions imex curation paca_human Pituitary adenylate cyclase-activating polypeptide ADCYAP1 protein protein human Homo sapiens Human MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPGAGSPASAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL mint Stimulates adenylate cyclase in pituitary cells p41586-3 Pituitary adenylate cyclase-activating polypeptide type I receptor ADCYAP1R1 protein protein human Homo sapiens Human MAGVVHVSLAALLLLPMAPAMHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQDMGVVSRNCTEDGWSEPFPHYFDACGFDEYESETGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRAISVFIKDWILYAEQDSNHCFISTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFFPERRYFYWYTIIGWGTPTVCVTVWATLRLYFDDTGCWDMNDSTALWWVIKGPVVGSIMVNFVLFIGIIVILVQKLQSPDMGGNESSIYLRLARSTLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKVNRYFAVDFKHRHPSLASSGVNGGTQLSILSKSSSQIRMSGLPADNLAT adcyap1-adcyap1r1-1 3155880 N/A 3155882 unspecified role unspecified role unspecified role unspecified role Region 137-169 Region 137-169 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3155883 unspecified role unspecified role unspecified role unspecified role Region 22-143 Region 22-143 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false adcyap1-adcyap1r1-2 3155881 N/A 3155882 unspecified role unspecified role unspecified role unspecified role Region 137-169 Region 137-169 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Oregon-label Oregon-label oregon green label oregon green label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3155883 unspecified role unspecified role unspecified role unspecified role Region 22-143 Region 22-143 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false