DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ busch-2007-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261432X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions imex curation busch-2007-2 emend Emericella nidulans Aspergillus nidulans tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261423X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions imex curation busch-2007-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261426X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions imex curation busch-2007-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261437X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions imex curation busch-2007-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261427X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions imex curation busch-2007-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261439X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions imex curation busch-2007-7 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261438X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions imex curation busch-2007-8 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261433X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions imex curation busch-2007-9 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261428X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions imex curation busch-2007-10 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261429X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions imex curation busch-2007-11 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261440X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions imex curation busch-2007-12 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261435X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions imex curation busch-2007-13 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261424X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions imex curation busch-2007-14 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261434X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions imex curation busch-2007-15 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261436X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions imex curation busch-2007-16 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261425X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions imex curation busch-2007-17 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261430X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions imex curation busch-2007-18 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261431X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions imex curation csn7_emeni COP9 signalosome complex subunit 7 csnG acoB csn7 AN3623 protein protein emeni Emericella nidulans Aspergillus nidulans MDQVHHRALDALQSFIALTDSSSATSPRYIASIITNATSSPHTYVFAELLERPAVQALRSPDTPAEFQSYLTLLEIFAWGTWQDYQQTPNLPPLSEEQARKLRLLTLLSLASTIKPLTYEALMTSLSLSAPSELESLVTTAIYSSLITGRLSPATNPPTVNVTSVAPLRDVKPSSLPTMISTLTAWEARCGSVISDIETEIAKIRADSAQRRQKEHARAVAIEKTLEKWNAEGGEQLQGGNPGQGQGQGQGGLGKNAGWKPRDLSTAMFERGFFGGGSNKREFDDDGYFDGGSSDFDQHGSGMDIDEGAGARASGARHSKRFLGKKS csn2_emeni COP9 signalosome complex subunit 2 csnB csn2 AN4783 protein protein emeni Emericella nidulans Aspergillus nidulans MSDDDDFMHDSADEEYDFEYEDADDDETGDIGIENKYYNAKQIKVDNPEEAIDEFLGVPALEQDKGDWGFKGLKQAIKLEFKLGRYSDAVEHYRELLTYVKSAVTRNYSEKSINNMLDYIEKGSDDEKAYQCMEEFYSLTLNSFQNTNNERLWLKTNIKLARLWLERREYGQLSKKVRELHRACQREDGSDDPSKGTYLLELYALEIQMYAETKNNKRLKALYQRALRVRSAVPHPKIMGIIRECGGKMHMSEENWEEAQSDFFESFRNYDEAGSMQRIQVLKYLVLTTMLMKSDINPFHSQETKPYKTDPRISAMTDLVDAFQRDDIHAYEEVLSKNPDVLADPFIAENIDEVSRNMRTKAILKLIAPYTRFTLSFISKHIKISVTEAQDILSFLILDKKLNAKIDQESGTVVVESASDVERLRSVEEWNESLRTLWQVTLKDGDGFKNDDVSQPTGIGMRGPLLYQSGLDDDTAGLLRSSGHRFRRGGKGSKAGGGLGMKTGLF csn8_emeni COP9 signalosome complex subunit 8 csnH csn8 AN10208 protein protein emeni Emericella nidulans Aspergillus nidulans MDLPPLSLDQLSAVITAGPTPTDLYTSLSAYEEQACLLSATDPSEKDLLLEFYTAFFFSHLLTDQICEARALTRRIPREISRLDAMQTCSLLLRAVWQSKHTEIYKILRELPWPGRSQPLVQRYESYFQEKTLVEMSNSYETIRIAAAATYLGLDPAAVEGDIIEKFTACGWKWDSEKQLLHPKPVVTAPPKDDSLQNELSRVMALISNQGS csn6_emeni COP9 signalosome complex subunit 6 csnF csn6 AN2233 protein protein emeni Emericella nidulans Aspergillus nidulans MPDEAISILSQKSSDSGLHIQLHPLALLTISDHITRHAARSQQGPIVGGLLGQHNGREITVEHGFECVVEIGPNGEAQLPNEWFVDRVKQFKDVHKVPALDLIGWWSTAPPSGPTTAHLPIHRQILQNHNESAVFLTFHPSQVQGASQSQGKLPLTIYESVYEGESVTENGKAMQVDGEEQLLNIRFRELPYTIETGEAEMIGIDTVARTARNAAATETSTVAAPSSQIDSDKQEQQPANTDLLSPEEEELIASLNTRLNAIRTLESRISLIKSYLSSISPSSEEGQKDSATKPDHTILRDINSLLSNLSLLTPHEQSAFSAETLAQNNDVSLVALLGQLSQSVNGMREVGKRTAIVNSVRRNRKQLGAQSRYEDDILGRDGVALG csn5_emeni COP9 signalosome complex subunit 5 rri1 csn5 csnE AN2129 protein protein emeni Emericella nidulans Aspergillus nidulans MQAAQLSWELENAVTLIDPQRDSLYRYDEETHKYLSDTRPWTKDPHYFKSVRISAVALLKMVMHARSGGSLEVMGLMQGYILPNTFVVTDAFRLPVEGTETRVNAQDEANEYMVSYLQSCREAGRMENAVGWYHSHPGYGCWLSGIDVSTQDMQQMSGPFVAVVIDPERTISAGKVDIGAFRTFPKDYTPPKEEQEEDEYQTVPLNKAEDFGAHASHYYSLEVSLFKSALDTEILSLLWNKYWVATLSQSPLFTTRDYGSKQMLDLSQKTRRVARGIESNPPRGGAPTQVRDQQLERVVKDGQRIVSEEVKGLLAAEVKMQLFQGIGGKQTVEST csn4_emeni COP9 signalosome complex subunit 4 csnD csn4 AN1539 protein protein emeni Emericella nidulans Aspergillus nidulans MPSQKIISALAEIESSASPQNKLQLYNDLLSETVSASPEPQLADDLIYYLDSVLSEDLSIVAARPILDSFIYTLRKLSSETQIKVAQHAVNLLQSRSASVEEQDAQIREILADAYEAEEEYIAAARALQGIHIDSSQRLVSDSAKVKLWIRIVRLYLEEDDTTSAEAFLNRIKNLPSKIEDHELKLHFRLSQARIQDARRRFLDASQEYFAVSLAAGVDESDRLQALAAAIRCAVLAPAGPQRSRTLATLYKDDRATSVEEFGILEKMFLDRLLTPEEVSAFAQRLAPHQLAQTADGTTVLDKAVVEHNLVAASKLYENIKTDALGAILGLQASGDLTAGEKAEAYAARMVEQGRLSGSIDQIDGIIYFESNTTATGRHIRQWDAGVQGLSEGVERVATNIAEGHLVR csn3_emeni COP9 signalosome complex subunit 3 csnC csn3 AN5798 protein protein emeni Emericella nidulans Aspergillus nidulans MSDFLAYLTSAPSRPHGSANITDKCYDHQLRDLIAYLKQPGVAPSTADINGYLEAISPAVHSLSYLYLLRIRIQQLQEKTAVGVPNDLQPGGTLWNQTVKFLRSFDPIQIRYVGHEWRELVDSVANAALSVSKPILAVKMIRDALERLNTAGVFTSLHLMLVKLALLSSSYTYVLPVLDKLLCHFPSDTQNAHAGILLCSEHEPSTVFFTDSSGFSANLTYRDHLQFYMYSGMVYMALKKWDQASHCLGIVISAPTANSVSKIMVEAYKKWVLANLLGHGKLFSVPNLVAPHVTRVYQSLSKPYISLAEAFEKRDFQRLRTEISLGQTIWRADKNSGLVYQVFEAYDKFLIIKLGKTFSALTMPDVLQRASSCSKGSRDIEEFVVSLVMTKELRAKLSHSPGNETTTMLRFPLSSQSHALREEHIRFRLIQKEAALNTISRAITQTKITLETSHENLQVIAKNQKLAGSSERSGVVGSTEADGGGDLDEDLMGDGR csn1_emeni COP9 signalosome complex subunit 1 csnA csn1 AN1491 protein protein emeni Emericella nidulans Aspergillus nidulans MEPMLPEAGEAALLSSYAPQASGSMGVDPDPITGLVSTSAAPLVRVEEAPKFELESYIANYTGRTRFNRLYLIGTCSSYLAVDALKAAIAEAKSGKDVARYLRAVQALADVAPNEPEATIDSDWVERSQKVVKAETDRLEHELRGYKNNLIKESIRMGNEELGQHYHRIGDLTSAFKAYSRMRDFCTTPSHIASMLFKIINVAIERGDWLNVQSNVHRLRSQGGKPEEQAKHQPKISAAMGLSQLHSGSYLEAANSFIATDPSLGDTFNEVLTSNDVAVYGGLCALASMDRNELQRRVLDNSSFRNFLELEPHIRRAISFFCNSKFRPCLEILEAYRADYLLDIHLQRHVQVLYNRIRTKSIQQYLIPFNRVSLESMAKIFVLGNPTSQSSQSDSKSAFVQELISLIQDGTLDARIDLEKHVLVSTQGDKRIEVQEAVLDSLDNYVREAHLRLLRSNIIRAGLEVRPLGEDRRTKLEERGKKGHSAIGNLLRATGMKQ csnb-csng-1 3155753 N/A 3155771 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3155772 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false rri1-csna-1 3155754 N/A 3155773 unspecified role unspecified role prey prey emend Emericella nidulans Aspergillus nidulans N/A 3155771 unspecified role unspecified role prey prey emend Emericella nidulans Aspergillus nidulans N/A 3155774 unspecified role unspecified role prey prey emend Emericella nidulans Aspergillus nidulans N/A 3155775 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false emend Emericella nidulans Aspergillus nidulans N/A 3155776 unspecified role unspecified role prey prey emend Emericella nidulans Aspergillus nidulans N/A 3155777 unspecified role unspecified role prey prey emend Emericella nidulans Aspergillus nidulans N/A 3155772 unspecified role unspecified role prey prey emend Emericella nidulans Aspergillus nidulans N/A 3155778 unspecified role unspecified role prey prey emend Emericella nidulans Aspergillus nidulans association association false false false csnb-csna-1 3155755 N/A 3155772 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3155778 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false csnf-csng-1 3155756 N/A 3155774 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3155771 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false csna-csnd-1 3155757 N/A 3155776 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3155778 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false rri1-csnf-1 3155758 N/A 3155775 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3155774 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false csnf-rri1-1 3155759 N/A 3155775 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3155774 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false csnd-csnd-1 3155760 N/A 3155776 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3155776 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false csnd-csna-1 3155761 N/A 3155776 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3155778 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false csnb-csnb-1 3155762 N/A 3155772 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3155772 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false csnf-csnf-1 3155763 N/A 3155774 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3155774 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false csng-csnd-1 3155764 N/A 3155771 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3155776 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false csna-csna-1 3155765 N/A 3155778 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3155778 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false csnd-csng-1 3155766 N/A 3155771 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3155776 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false csng-csnf-1 3155767 N/A 3155774 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3155771 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false csna-csnb-1 3155768 N/A 3155772 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3155778 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false csnb-csnd-1 3155769 N/A 3155776 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3155772 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false csnd-csnb-1 3155770 N/A 3155776 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3155772 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false