DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ tan-2007-1 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Tan X., Calderon-Villalobos LI., Sharon M., Zheng C., Robinson CV., Estelle M., Zheng N. DIP original experiment: DIP-253293X Nature 2007 IMEx Mechanism of auxin perception by the TIR1 ubiquitin ligase. Tan X., Calderon-Villalobos LI., Sharon M., Zheng C., Robinson CV., Estelle M., Zheng N. Only protein-protein interactions imex curation tan-2007-2 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Tan X., Calderon-Villalobos LI., Sharon M., Zheng C., Robinson CV., Estelle M., Zheng N. DIP original experiment: DIP-253296X Nature 2007 IMEx Mechanism of auxin perception by the TIR1 ubiquitin ligase. Tan X., Calderon-Villalobos LI., Sharon M., Zheng C., Robinson CV., Estelle M., Zheng N. Only protein-protein interactions imex curation tan-2007-3 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Tan X., Calderon-Villalobos LI., Sharon M., Zheng C., Robinson CV., Estelle M., Zheng N. DIP original experiment: DIP-253298X Nature 2007 IMEx Mechanism of auxin perception by the TIR1 ubiquitin ligase. Tan X., Calderon-Villalobos LI., Sharon M., Zheng C., Robinson CV., Estelle M., Zheng N. Only protein-protein interactions imex curation tan-2007-4 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Tan X., Calderon-Villalobos LI., Sharon M., Zheng C., Robinson CV., Estelle M., Zheng N. DIP original experiment: DIP-253294X Nature 2007 IMEx Mechanism of auxin perception by the TIR1 ubiquitin ligase. Tan X., Calderon-Villalobos LI., Sharon M., Zheng C., Robinson CV., Estelle M., Zheng N. Only protein-protein interactions imex curation tan-2007-5 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Tan X., Calderon-Villalobos LI., Sharon M., Zheng C., Robinson CV., Estelle M., Zheng N. DIP original experiment: DIP-253299X Nature 2007 IMEx Mechanism of auxin perception by the TIR1 ubiquitin ligase. Tan X., Calderon-Villalobos LI., Sharon M., Zheng C., Robinson CV., Estelle M., Zheng N. Only protein-protein interactions imex curation tan-2007-6 in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Tan X., Calderon-Villalobos LI., Sharon M., Zheng C., Robinson CV., Estelle M., Zheng N. DIP original experiment: DIP-253297X Nature 2007 IMEx Mechanism of auxin perception by the TIR1 ubiquitin ligase. Tan X., Calderon-Villalobos LI., Sharon M., Zheng C., Robinson CV., Estelle M., Zheng N. Only protein-protein interactions imex curation tan-2007-7 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Tan X., Calderon-Villalobos LI., Sharon M., Zheng C., Robinson CV., Estelle M., Zheng N. DIP original experiment: DIP-253295X Nature 2007 IMEx Mechanism of auxin perception by the TIR1 ubiquitin ligase. Tan X., Calderon-Villalobos LI., Sharon M., Zheng C., Robinson CV., Estelle M., Zheng N. Only protein-protein interactions imex curation tir1_arath Protein TRANSPORT INHIBITOR RESPONSE 1 TIR1 FBL1 WEI1 T20O10.80 At3g62980 Weak ethylene-insensitive protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVSPATVIRRFPKVRSVELKGKPHFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRAVPLEKLATLLQRAPQLEELGTGGYTAEVRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYATVQSYDLVKLLCQCPKLQRLWVLDYIEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESVLYFCRQMTNAALITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLSGLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCDSLRKLEIRDCPFGDKALLANASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDERGAPDSRPESCPVERVFIYRTVAGPRFDMPGFVWNMDQDSTMRFSRQIITTNGL skp1a_arath SKP1-like protein 1A UFO-binding protein 1 SKP1 UIP1 At1g75950 T4O12.17 SKP1A ASK1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKRHVEAAASKAEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE iaa7_arath Auxin-responsive protein IAA7 Indoleacetic acid-induced protein 7 Auxin resistant 2 IAA7 AXR2 At3g23050 MXC7.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MIGQLMNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKNVSAVPKEKTTLKDPSKPPAKAQVVGWPPVRNYRKNMMTQQKTSSGAEEASSEKAGNFGGGAAGAGLVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAVGLAPRAMEKYCKNRS skp1a-tir1-1 3154867 N/A 3154874 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3154875 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false skp1a-tir1-2 3154868 N/A 3154874 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3154875 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false iaa7-skp1a-1 3154869 N/A 3154876 unspecified role unspecified role unspecified role unspecified role Region 82-94 Region 82-94 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3154874 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3154875 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false skp1a-tir1-3 3154870 N/A 3154874 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3154875 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false tir1-iaa7-1 3154871 N/A 3154876 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3154874 unspecified role unspecified role bait bait GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false iaa7-skp1a-2 3154872 N/A 3154876 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3154874 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3154875 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false skp1a-tir1-4 3154873 N/A 3154874 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3154875 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false